Clone IP02725 Report

Search the DGRC for IP02725

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:27
Well:25
Vector:pOT2
Associated Gene/TranscriptSkpB-RA
Protein status:IP02725.pep: gold
Preliminary Size:621
Sequenced Size:650

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8881 2005-01-01 Successful iPCR screen
skpB 2008-04-29 Release 5.5 accounting

Clone Sequence Records

IP02725.complete Sequence

650 bp (650 high quality bases) assembled on 2005-03-01

GenBank Submission: BT023253

> IP02725.complete
AGAGATGCCCATCATTCGGCTGGAGTCTGCGGACAAGGAGATCTTTGACA
CGGATCAGGAGATCGCCAAGTGCTCGGAAACGATTCGCATTGCAATAGAG
GATTTGGGCGATGAGAGCGACAACAGTGTGCTGCCGTTGCCGAATGTCAA
CTCGCTGATCCTGAAGAAAGTGCTCCACTGGGCCACCTATCACAAGGACG
ATCCTGTGGTTACCGAAGAGGTTGAGAACAAGGAGAAGCGCACTGATGAC
ATCTCATCCTGGGACGCTGACTTTCTCAAAGTCGACCAGGGCACGCTGTT
CGAACTGATCCTCGCGGCAAACTACCTGAATATCCAGGGTCTGCTCGACG
TCACCTGCAAGACGGTGGCCAATATGATCAAGGGCAAGTCGCCGCAGGCT
ATTCGCGACACCTTCGCCATCCAGAATGACTTTCTGCCACAGGAGGAGGA
ACAGGTGCGCAAGGAGAACGAGTGGTGTGAGGATAAATGAATACCATCAA
CTTACCATGACGAAATTAAAGCTTAAATTTTTTGTTTAATCAACATTTCA
ATTGAGATAGTTAGCTGATCATGTTAAGAGTCAGCAATTGTTCTGTTGGG
TTAATTAAATAAAATATTATGCTTTAATGTTGGCAAAAAAAAAAAAAAAA

IP02725.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:54:16
Subject Length Description Subject Range Query Range Score Percent Strand
skpB-RA 908 skpB-RA 275..908 1..634 3170 100 Plus
skpA.e 870 skpA.e 297..557 223..483 420 77.3 Plus
skpA.f 875 skpA.f 302..562 223..483 420 77.3 Plus
skpA.e 870 skpA.e 97..146 26..75 145 86 Plus
skpA.f 875 skpA.f 102..151 26..75 145 86 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:25:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8026498..8027131 634..1 3170 100 Minus
chrX 22417052 chrX 551212..551563 132..483 440 75 Plus
chrX 22417052 chrX 19705057..19705233 246..422 210 74.6 Plus
chr2R 21145070 chr2R 19344583..19344681 385..287 195 79.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:35:36 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:25:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12139293..12139928 636..1 3180 100 Minus
X 23542271 X 657240..657591 132..483 440 75 Plus
X 23542271 X 19816391..19816567 246..422 210 74.6 Plus
2R 25286936 2R 23458303..23458401 385..287 195 79.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:43:12
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12140492..12141127 636..1 3180 100 Minus
X 23527363 X 665429..665689 223..483 420 77.3 Plus
2R 25260384 2R 23459502..23459600 385..287 195 79.7 Minus
X 23527363 X 665229..665278 26..75 145 86 Plus
Blast to na_te.dros performed 2019-03-16 17:25:39
Subject Length Description Subject Range Query Range Score Percent Strand
jockey2 3428 jockey2 JOCKEY2 3428bp 3316..3407 536..628 129 62.8 Plus

IP02725.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:26:36 Download gff for IP02725.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8026498..8027131 1..634 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:18:36 Download gff for IP02725.complete
Subject Subject Range Query Range Percent Splice Strand
skpB-RA 1..486 5..490 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:26:51 Download gff for IP02725.complete
Subject Subject Range Query Range Percent Splice Strand
skpB-RA 1..486 5..490 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:55:52 Download gff for IP02725.complete
Subject Subject Range Query Range Percent Splice Strand
skpB-RA 1..486 5..490 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:10:54 Download gff for IP02725.complete
Subject Subject Range Query Range Percent Splice Strand
skpB-RA 1..486 5..490 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:58:44 Download gff for IP02725.complete
Subject Subject Range Query Range Percent Splice Strand
SkpB-RA 1..486 5..490 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:29:52 Download gff for IP02725.complete
Subject Subject Range Query Range Percent Splice Strand
skpB-RA 77..621 1..545 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:26:51 Download gff for IP02725.complete
Subject Subject Range Query Range Percent Splice Strand
skpB-RA 77..710 1..634 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:55:52 Download gff for IP02725.complete
Subject Subject Range Query Range Percent Splice Strand
skpB-RA 244..877 1..634 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:10:54 Download gff for IP02725.complete
Subject Subject Range Query Range Percent Splice Strand
skpB-RA 77..621 1..545 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:58:44 Download gff for IP02725.complete
Subject Subject Range Query Range Percent Splice Strand
SkpB-RA 244..877 1..634 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:26:36 Download gff for IP02725.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12139295..12139928 1..634 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:26:36 Download gff for IP02725.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12139295..12139928 1..634 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:26:36 Download gff for IP02725.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12139295..12139928 1..634 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:55:52 Download gff for IP02725.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8026800..8027433 1..634 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:47:25 Download gff for IP02725.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12140494..12141127 1..634 100   Minus

IP02725.hyp Sequence

Translation from 0 to 489

> IP02725.hyp
EMPIIRLESADKEIFDTDQEIAKCSETIRIAIEDLGDESDNSVLPLPNVN
SLILKKVLHWATYHKDDPVVTEEVENKEKRTDDISSWDADFLKVDQGTLF
ELILAANYLNIQGLLDVTCKTVANMIKGKSPQAIRDTFAIQNDFLPQEEE
QVRKENEWCEDK*

IP02725.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:52:59
Subject Length Description Subject Range Query Range Score Percent Strand
SkpB-PA 161 CG8881-PA 1..161 2..162 835 100 Plus
SkpA-PI 162 CG16983-PI 1..162 2..162 622 73.5 Plus
SkpA-PH 162 CG16983-PH 1..162 2..162 622 73.5 Plus
SkpA-PA 162 CG16983-PA 1..162 2..162 622 73.5 Plus
SkpA-PD 162 CG16983-PD 1..162 2..162 622 73.5 Plus

IP02725.pep Sequence

Translation from 4 to 489

> IP02725.pep
MPIIRLESADKEIFDTDQEIAKCSETIRIAIEDLGDESDNSVLPLPNVNS
LILKKVLHWATYHKDDPVVTEEVENKEKRTDDISSWDADFLKVDQGTLFE
LILAANYLNIQGLLDVTCKTVANMIKGKSPQAIRDTFAIQNDFLPQEEEQ
VRKENEWCEDK*

IP02725.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:21:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11136-PA 161 GF11136-PA 1..161 1..161 772 90.7 Plus
Dana\GF12644-PA 161 GF12644-PA 1..161 1..161 756 89.4 Plus
Dana\GF21176-PA 248 GF21176-PA 1..162 1..160 608 73.5 Plus
Dana\GF11848-PA 179 GF11848-PA 1..162 1..154 437 57.4 Plus
Dana\GF21823-PA 200 GF21823-PA 1..141 3..132 152 30.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:21:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22608-PA 162 GG22608-PA 1..161 1..161 808 95 Plus
Dere\GG12805-PA 162 GG12805-PA 1..162 1..161 620 73.5 Plus
Dere\GG20030-PA 170 GG20030-PA 1..150 1..149 434 56.7 Plus
Dere\GG19259-PA 157 GG19259-PA 3..156 1..160 377 49.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:21:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20861-PA 162 GH20861-PA 1..162 1..161 705 85.2 Plus
Dgri\GH24518-PA 162 GH24518-PA 1..162 1..161 623 73.5 Plus
Dgri\GH19712-PA 162 GH19712-PA 1..162 1..161 623 73.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:53:03
Subject Length Description Subject Range Query Range Score Percent Strand
SkpB-PA 161 CG8881-PA 1..161 1..161 835 100 Plus
SkpA-PI 162 CG16983-PI 1..162 1..161 622 73.5 Plus
SkpA-PH 162 CG16983-PH 1..162 1..161 622 73.5 Plus
SkpA-PA 162 CG16983-PA 1..162 1..161 622 73.5 Plus
SkpA-PD 162 CG16983-PD 1..162 1..161 622 73.5 Plus
SkpA-PG 162 CG16983-PG 1..162 1..161 622 73.5 Plus
SkpA-PB 162 CG16983-PB 1..162 1..161 622 73.5 Plus
SkpA-PC 162 CG16983-PC 1..162 1..161 622 73.5 Plus
SkpA-PF 162 CG16983-PF 1..162 1..161 622 73.5 Plus
SkpA-PE 162 CG16983-PE 1..162 1..161 622 73.5 Plus
SkpF-PA 171 CG12227-PA 1..157 1..156 436 56.1 Plus
SkpC-PA 158 CG11941-PA 4..157 2..154 374 51.6 Plus
SkpD-PA 158 CG12700-PA 4..146 2..142 359 52.4 Plus
SkpE-PA 167 CG11942-PA 4..156 2..152 304 44.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:21:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20969-PA 162 GI20969-PA 1..162 1..161 721 86.4 Plus
Dmoj\GI15084-PA 162 GI15084-PA 1..162 1..161 633 74.7 Plus
Dmoj\GI11198-PA 148 GI11198-PA 1..140 1..140 330 50.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:21:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16990-PA 162 GL16990-PA 1..162 1..161 758 90.7 Plus
Dper\GL13359-PA 162 GL13359-PA 1..162 1..161 618 73.5 Plus
Dper\GL13358-PA 162 GL13358-PA 1..162 1..161 618 73.5 Plus
Dper\GL14141-PA 162 GL14141-PA 1..162 1..161 618 73.5 Plus
Dper\GL15335-PA 162 GL15335-PA 1..162 1..161 612 72.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:21:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21386-PA 162 GA21386-PA 1..162 1..161 759 90.7 Plus
Dpse\GA14255-PA 162 GA14255-PA 1..162 1..161 615 72.8 Plus
Dpse\GA26756-PA 164 GA26756-PA 1..164 1..161 544 64.6 Plus
Dpse\GA26757-PA 164 GA26757-PA 1..164 1..161 509 62.2 Plus
Dpse\GA23292-PA 132 GA23292-PA 27..132 56..161 443 78.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:21:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20386-PA 161 GM20386-PA 1..161 1..161 829 98.1 Plus
Dsec\GM19084-PA 162 GM19084-PA 1..162 1..161 619 73.5 Plus
Dsec\GM15542-PA 170 GM15542-PA 1..150 1..149 411 55.3 Plus
Dsec\GM22995-PA 168 GM22995-PA 15..167 3..154 329 49 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:21:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25859-PA 161 GD25859-PA 1..161 1..161 835 98.8 Plus
Dsim\GD25861-PA 128 GD25861-PA 1..128 34..161 668 98.4 Plus
Dsim\GD16521-PA 162 GD16521-PA 1..162 1..161 619 73.5 Plus
Dsim\GD25046-PA 170 GD25046-PA 1..150 1..149 412 55.3 Plus
Dsim\GD17469-PA 157 GD17469-PA 15..157 3..143 304 46.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:21:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20688-PA 162 GJ20688-PA 1..162 1..161 712 85.8 Plus
Dvir\GJ18891-PA 200 GJ18891-PA 39..200 1..161 631 74.1 Plus
Dvir\GJ18483-PA 150 GJ18483-PA 1..142 1..140 365 52.8 Plus
Dvir\GJ22314-PA 140 GJ22314-PA 1..137 1..148 310 45.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:21:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21342-PA 161 GK21342-PA 1..161 1..161 768 90.7 Plus
Dwil\GK16428-PA 162 GK16428-PA 1..162 1..161 610 72.8 Plus
Dwil\GK21211-PA 162 GK21211-PA 1..162 1..161 518 64.2 Plus
Dwil\GK17839-PA 154 GK17839-PA 1..150 1..160 467 59.4 Plus
Dwil\GK23055-PA 154 GK23055-PA 1..154 1..156 458 56.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:21:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13476-PA 162 GE13476-PA 1..161 1..161 813 95.7 Plus
Dyak\skpA-PA 162 GE16631-PA 1..162 1..161 617 72.8 Plus
Dyak\GE11566-PA 172 GE11566-PA 1..149 1..149 417 56.3 Plus