Clone IP02731 Report

Search the DGRC for IP02731

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:27
Well:31
Vector:pOT2
Associated Gene/TranscriptAcp26Aa-RA
Protein status:IP02731.pep: gold
Preliminary Size:958
Sequenced Size:955

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8982 2005-01-01 Successful iPCR screen
Acp26Aa 2008-04-29 Release 5.5 accounting
Acp26Aa 2008-08-15 Release 5.9 accounting
Acp26Aa 2008-12-18 5.12 accounting

Clone Sequence Records

IP02731.complete Sequence

955 bp (955 high quality bases) assembled on 2006-01-20

GenBank Submission: BT024423

> IP02731.complete
ATGAACCAGATTTTATTATGCTCTCCAATTTTACTGCTGCTTTTTACAGT
GGCAAGCTGCGATAGTGAGCAACAACTCGATTCAGCTATGCACCTGAAAA
GTGATTCTACGAAAAGTGCATCTCTGAAAAATGTTGCTCCCAAGAATGAT
GAGACACAGGCCAAAATAGCCAAAGATGATGTAGCTCTGAAAGATGCGAA
AAAGGGCGATTATATAATGGATATCGATATTTCTGATTTGCCGCTGGATG
ATTATCCAATCAATAGGTCCAAATCACTAAAAAGCTCTTCCATTGACTTG
AATAATATTCCTTTCAATAAAGGACTAGATGATTTCCCGGCAAAAGAAAA
AAATCAAGGATCCAATCAAAGTGCGCTCAAGGCCCTGCAACAGAGGTTAC
TAACGGAGCAGAACAATAGTTTACTTCTCCGGAACCATTCCATATACTTG
ATGAAAGAAATAGAGGCCAGAAAAACGGATATTATCAAAGTACGACAGTT
AAACCTCGATTTAGAGCTCGAGCTAAATACTGTGAACCGCAGACTTTTGG
AATTGAATGGGCAACTGCAAAACACTCGAAAGTCCACAAAGCCGTGTAAG
AAACGTTCTAGTAAGGATAGCGCCCCACCTGCCGCCAATCAGTTTCAGGA
AGCCAACGTCAGGAACACTTACCGTAACAAATATCTAACACTTCTGAAAG
AACTTAGTCAGAAGATCAATAACGAAATCGCGAAAGTCGCTACCGATGTA
CCCACGGAGACAAATCCTTCCCAAGGGAATCTACCAACACTTTAATAGTT
AAAATCATATGGTTTCCCATCATTTAAGAACAGAAACAATAGTATTGAGT
CATTGCAAGACCTTCTAATTGCGCACTTACTTATTTTTCTGATCTTGTTA
GCCGTAATAAATGCGATTCATAACGCTTAGGCCAAAAAAAAAAAAAAAAA
AAAAA

IP02731.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:19:37
Subject Length Description Subject Range Query Range Score Percent Strand
Acp26Aa-RA 968 Acp26Aa-RA 36..968 1..933 4665 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:19:17
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 5891934..5892837 933..30 4505 99.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:35:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:19:15
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5892881..5893786 935..30 4515 99.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:12:27
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5892881..5893786 935..30 4515 99.8 Minus
2L 23513712 2L 5893838..5893871 34..1 170 100 Minus
Blast to na_te.dros performed on 2019-03-16 03:19:15 has no hits.

IP02731.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:20:01 Download gff for IP02731.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 5891934..5892832 35..933 100 <- Minus
chr2L 5892889..5892922 1..34 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:18:39 Download gff for IP02731.complete
Subject Subject Range Query Range Percent Splice Strand
Acp26Aa-RA 1..795 1..795 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:34:33 Download gff for IP02731.complete
Subject Subject Range Query Range Percent Splice Strand
Acp26Aa-RA 1..795 1..795 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:57:02 Download gff for IP02731.complete
Subject Subject Range Query Range Percent Splice Strand
Acp26Aa-RA 1..795 1..795 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:08:43 Download gff for IP02731.complete
Subject Subject Range Query Range Percent Splice Strand
Acp26Aa-RA 1..795 1..795 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:35:35 Download gff for IP02731.complete
Subject Subject Range Query Range Percent Splice Strand
Acp26Aa-RA 1..795 1..795 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:05:49 Download gff for IP02731.complete
Subject Subject Range Query Range Percent Splice Strand
Acp26Aa-RA 26..958 1..933 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:34:33 Download gff for IP02731.complete
Subject Subject Range Query Range Percent Splice Strand
Acp26Aa-RA 26..958 1..933 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:57:02 Download gff for IP02731.complete
Subject Subject Range Query Range Percent Splice Strand
Acp26Aa-RA 26..958 1..933 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:08:43 Download gff for IP02731.complete
Subject Subject Range Query Range Percent Splice Strand
Acp26Aa-RA 26..958 1..933 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:35:35 Download gff for IP02731.complete
Subject Subject Range Query Range Percent Splice Strand
Acp26Aa-RA 26..958 1..933 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:20:01 Download gff for IP02731.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5892883..5893781 35..933 100 <- Minus
2L 5893838..5893871 1..34 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:20:01 Download gff for IP02731.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5892883..5893781 35..933 100 <- Minus
2L 5893838..5893871 1..34 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:20:01 Download gff for IP02731.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5892883..5893781 35..933 100 <- Minus
2L 5893838..5893871 1..34 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:57:02 Download gff for IP02731.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5892883..5893781 35..933 100 <- Minus
arm_2L 5893838..5893871 1..34 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:58:34 Download gff for IP02731.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5892883..5893781 35..933 100 <- Minus
2L 5893838..5893871 1..34 100   Minus

IP02731.pep Sequence

Translation from 0 to 794

> IP02731.pep
MNQILLCSPILLLLFTVASCDSEQQLDSAMHLKSDSTKSASLKNVAPKND
ETQAKIAKDDVALKDAKKGDYIMDIDISDLPLDDYPINRSKSLKSSSIDL
NNIPFNKGLDDFPAKEKNQGSNQSALKALQQRLLTEQNNSLLLRNHSIYL
MKEIEARKTDIIKVRQLNLDLELELNTVNRRLLELNGQLQNTRKSTKPCK
KRSSKDSAPPAANQFQEANVRNTYRNKYLTLLKELSQKINNEIAKVATDV
PTETNPSQGNLPTL*

IP02731.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:15:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24276-PA 239 GG24276-PA 1..220 1..247 335 38.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:14:15
Subject Length Description Subject Range Query Range Score Percent Strand
Acp26Aa-PA 264 CG8982-PA 1..264 1..264 1323 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:15:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\Acp26Aa-PA 255 GM17990-PA 15..254 15..263 794 68.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:15:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Acp26Aa-PA 255 GD22626-PA 1..254 1..263 798 68 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:15:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Acp26Aa-PA 246 GE18973-PA 1..238 1..245 397 38.4 Plus

IP02731.hyp Sequence

Translation from 1 to 794

> IP02731.hyp
MNQILLCSPILLLLFTVASCDSEQQLDSAMHLKSDSTKSASLKNVAPKND
ETQAKIAKDDVALKDAKKGDYIMDIDISDLPLDDYPINRSKSLKSSSIDL
NNIPFNKGLDDFPAKEKNQGSNQSALKALQQRLLTEQNNSLLLRNHSIYL
MKEIEARKTDIIKVRQLNLDLELELNTVNRRLLELNGQLQNTRKSTKPCK
KRSSKDSAPPAANQFQEANVRNTYRNKYLTLLKELSQKINNEIAKVATDV
PTETNPSQGNLPTL*

IP02731.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:53:03
Subject Length Description Subject Range Query Range Score Percent Strand
Acp26Aa-PA 264 CG8982-PA 1..264 1..264 1323 100 Plus