Clone IP02733 Report

Search the DGRC for IP02733

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:27
Well:33
Vector:pOT2
Associated Gene/TranscriptAcp26Ab-RA
Protein status:IP02733.pep: gold
Preliminary Size:504
Sequenced Size:410

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9024 2005-01-01 Successful iPCR screen
Acp26Ab 2008-04-29 Release 5.5 accounting
Acp26Ab 2008-08-15 Release 5.9 accounting
Acp26Ab 2008-12-18 5.12 accounting

Clone Sequence Records

IP02733.complete Sequence

410 bp (410 high quality bases) assembled on 2005-03-01

GenBank Submission: BT023248

> IP02733.complete
CCACAATGAACTACTTCGCGGTGATCTGCATTTTCTCCTGCATTTGCCTT
TGGCAATTTAGCGATGCTGCCCCCTTTATAAGCGTTCAGTCTAGTTCACA
ATCAAGATCCCAGAAAGTGATGAATGGCATGTTGAGAACCCTATACGACT
ACAGTGTTCAGGATAGTGTGAACGATGCGACTGGGCATTTGATACAAACT
CACAAAGCAGACTTCAACTCGGATGTCATGAGTCCTGATGAAATAGAGAG
TGTGCGCCAGCAACTGAACATGGCATAATTTTGGATTCACCAGCAAATAT
CTTAAACAGCGATTATTGCATATGCTTTTTAACCGCAGTTACTTCAAGCA
AAATATTATGTATCTATGCAATATGTAATATATCATTTAAAAAAAAAAAA
AAAAAAAAAA

IP02733.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:51:09
Subject Length Description Subject Range Query Range Score Percent Strand
Acp26Ab-RA 468 Acp26Ab-RA 41..432 1..392 1960 100 Plus
Acp26Ab-RB 524 Acp26Ab-RB 41..432 1..392 1960 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:52:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 5891445..5891796 388..37 1760 100 Minus
chr2L 23010047 chr2L 5891858..5891893 36..1 180 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:35:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:52:21
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5892390..5892745 392..37 1780 100 Minus
2L 23513712 2L 5892807..5892842 36..1 180 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:10:43
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5892390..5892745 392..37 1780 100 Minus
2L 23513712 2L 5892807..5892842 36..1 180 100 Minus
Blast to na_te.dros performed on 2019-03-16 19:52:22 has no hits.

IP02733.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:53:19 Download gff for IP02733.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 5891445..5891796 37..388 100 <- Minus
chr2L 5891858..5891893 1..36 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:18:41 Download gff for IP02733.complete
Subject Subject Range Query Range Percent Splice Strand
Acp26Ab-RB 1..273 6..278 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:47:03 Download gff for IP02733.complete
Subject Subject Range Query Range Percent Splice Strand
Acp26Ab-RB 1..273 6..278 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:49:09 Download gff for IP02733.complete
Subject Subject Range Query Range Percent Splice Strand
Acp26Ab-RA 1..273 6..278 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:28:07 Download gff for IP02733.complete
Subject Subject Range Query Range Percent Splice Strand
Acp26Ab-RB 1..273 6..278 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:45:00 Download gff for IP02733.complete
Subject Subject Range Query Range Percent Splice Strand
Acp26Ab-RA 1..273 6..278 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:56:20 Download gff for IP02733.complete
Subject Subject Range Query Range Percent Splice Strand
Acp26Ab-RB 21..408 1..388 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:47:02 Download gff for IP02733.complete
Subject Subject Range Query Range Percent Splice Strand
Acp26Ab-RB 21..408 1..388 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:49:09 Download gff for IP02733.complete
Subject Subject Range Query Range Percent Splice Strand
Acp26Ab-RA 21..408 1..388 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:28:07 Download gff for IP02733.complete
Subject Subject Range Query Range Percent Splice Strand
Acp26Ab-RB 21..408 1..388 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:45:00 Download gff for IP02733.complete
Subject Subject Range Query Range Percent Splice Strand
Acp26Ab-RA 21..408 1..388 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:53:19 Download gff for IP02733.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5892394..5892745 37..388 100 <- Minus
2L 5892807..5892842 1..36 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:53:19 Download gff for IP02733.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5892394..5892745 37..388 100 <- Minus
2L 5892807..5892842 1..36 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:53:19 Download gff for IP02733.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5892394..5892745 37..388 100 <- Minus
2L 5892807..5892842 1..36 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:49:09 Download gff for IP02733.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5892394..5892745 37..388 100 <- Minus
arm_2L 5892807..5892842 1..36 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:02:50 Download gff for IP02733.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5892394..5892745 37..388 100 <- Minus
2L 5892807..5892842 1..36 100   Minus

IP02733.hyp Sequence

Translation from 2 to 277

> IP02733.hyp
TMNYFAVICIFSCICLWQFSDAAPFISVQSSSQSRSQKVMNGMLRTLYDY
SVQDSVNDATGHLIQTHKADFNSDVMSPDEIESVRQQLNMA*

IP02733.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:53:07
Subject Length Description Subject Range Query Range Score Percent Strand
Acp26Ab-PC 90 CG9024-PC 1..90 2..91 466 100 Plus
Acp26Ab-PB 90 CG9024-PB 1..90 2..91 466 100 Plus
Acp26Ab-PA 90 CG9024-PA 1..90 2..91 466 100 Plus

IP02733.pep Sequence

Translation from 5 to 277

> IP02733.pep
MNYFAVICIFSCICLWQFSDAAPFISVQSSSQSRSQKVMNGMLRTLYDYS
VQDSVNDATGHLIQTHKADFNSDVMSPDEIESVRQQLNMA*

IP02733.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:41:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14297-PA 75 GF14297-PA 1..70 18..87 147 48.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:41:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24278-PA 91 GG24278-PA 1..87 1..87 318 70.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:51
Subject Length Description Subject Range Query Range Score Percent Strand
Acp26Ab-PC 90 CG9024-PC 1..90 1..90 466 100 Plus
Acp26Ab-PB 90 CG9024-PB 1..90 1..90 466 100 Plus
Acp26Ab-PA 90 CG9024-PA 1..90 1..90 466 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:41:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\Acp26Ab-PA 90 GM17991-PA 1..90 1..90 398 93.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:41:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Acp26Ab-PA 90 GD22627-PA 1..90 1..90 396 92.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:41:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18974-PA 96 GE18974-PA 1..87 1..87 321 74.7 Plus