IP02733.complete Sequence
410 bp (410 high quality bases) assembled on 2005-03-01
GenBank Submission: BT023248
> IP02733.complete
CCACAATGAACTACTTCGCGGTGATCTGCATTTTCTCCTGCATTTGCCTT
TGGCAATTTAGCGATGCTGCCCCCTTTATAAGCGTTCAGTCTAGTTCACA
ATCAAGATCCCAGAAAGTGATGAATGGCATGTTGAGAACCCTATACGACT
ACAGTGTTCAGGATAGTGTGAACGATGCGACTGGGCATTTGATACAAACT
CACAAAGCAGACTTCAACTCGGATGTCATGAGTCCTGATGAAATAGAGAG
TGTGCGCCAGCAACTGAACATGGCATAATTTTGGATTCACCAGCAAATAT
CTTAAACAGCGATTATTGCATATGCTTTTTAACCGCAGTTACTTCAAGCA
AAATATTATGTATCTATGCAATATGTAATATATCATTTAAAAAAAAAAAA
AAAAAAAAAA
IP02733.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 20:51:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Acp26Ab-RA | 468 | Acp26Ab-RA | 41..432 | 1..392 | 1960 | 100 | Plus |
Acp26Ab-RB | 524 | Acp26Ab-RB | 41..432 | 1..392 | 1960 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:52:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 5891445..5891796 | 388..37 | 1760 | 100 | Minus |
chr2L | 23010047 | chr2L | 5891858..5891893 | 36..1 | 180 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:35:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:52:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 5892390..5892745 | 392..37 | 1780 | 100 | Minus |
2L | 23513712 | 2L | 5892807..5892842 | 36..1 | 180 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:10:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 5892390..5892745 | 392..37 | 1780 | 100 | Minus |
2L | 23513712 | 2L | 5892807..5892842 | 36..1 | 180 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 19:52:22 has no hits.
IP02733.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:53:19 Download gff for
IP02733.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 5891445..5891796 | 37..388 | 100 | <- | Minus |
chr2L | 5891858..5891893 | 1..36 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:18:41 Download gff for
IP02733.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp26Ab-RB | 1..273 | 6..278 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:47:03 Download gff for
IP02733.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp26Ab-RB | 1..273 | 6..278 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:49:09 Download gff for
IP02733.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp26Ab-RA | 1..273 | 6..278 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:28:07 Download gff for
IP02733.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp26Ab-RB | 1..273 | 6..278 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:45:00 Download gff for
IP02733.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp26Ab-RA | 1..273 | 6..278 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:56:20 Download gff for
IP02733.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp26Ab-RB | 21..408 | 1..388 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:47:02 Download gff for
IP02733.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp26Ab-RB | 21..408 | 1..388 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:49:09 Download gff for
IP02733.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp26Ab-RA | 21..408 | 1..388 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:28:07 Download gff for
IP02733.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp26Ab-RB | 21..408 | 1..388 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:45:00 Download gff for
IP02733.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Acp26Ab-RA | 21..408 | 1..388 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:53:19 Download gff for
IP02733.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 5892394..5892745 | 37..388 | 100 | <- | Minus |
2L | 5892807..5892842 | 1..36 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:53:19 Download gff for
IP02733.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 5892394..5892745 | 37..388 | 100 | <- | Minus |
2L | 5892807..5892842 | 1..36 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:53:19 Download gff for
IP02733.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 5892394..5892745 | 37..388 | 100 | <- | Minus |
2L | 5892807..5892842 | 1..36 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:49:09 Download gff for
IP02733.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 5892394..5892745 | 37..388 | 100 | <- | Minus |
arm_2L | 5892807..5892842 | 1..36 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:02:50 Download gff for
IP02733.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 5892394..5892745 | 37..388 | 100 | <- | Minus |
2L | 5892807..5892842 | 1..36 | 100 | | Minus |
IP02733.hyp Sequence
Translation from 2 to 277
> IP02733.hyp
TMNYFAVICIFSCICLWQFSDAAPFISVQSSSQSRSQKVMNGMLRTLYDY
SVQDSVNDATGHLIQTHKADFNSDVMSPDEIESVRQQLNMA*
IP02733.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:53:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Acp26Ab-PC | 90 | CG9024-PC | 1..90 | 2..91 | 466 | 100 | Plus |
Acp26Ab-PB | 90 | CG9024-PB | 1..90 | 2..91 | 466 | 100 | Plus |
Acp26Ab-PA | 90 | CG9024-PA | 1..90 | 2..91 | 466 | 100 | Plus |
IP02733.pep Sequence
Translation from 5 to 277
> IP02733.pep
MNYFAVICIFSCICLWQFSDAAPFISVQSSSQSRSQKVMNGMLRTLYDYS
VQDSVNDATGHLIQTHKADFNSDVMSPDEIESVRQQLNMA*
IP02733.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:41:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF14297-PA | 75 | GF14297-PA | 1..70 | 18..87 | 147 | 48.6 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:41:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG24278-PA | 91 | GG24278-PA | 1..87 | 1..87 | 318 | 70.1 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Acp26Ab-PC | 90 | CG9024-PC | 1..90 | 1..90 | 466 | 100 | Plus |
Acp26Ab-PB | 90 | CG9024-PB | 1..90 | 1..90 | 466 | 100 | Plus |
Acp26Ab-PA | 90 | CG9024-PA | 1..90 | 1..90 | 466 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:41:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\Acp26Ab-PA | 90 | GM17991-PA | 1..90 | 1..90 | 398 | 93.3 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:41:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\Acp26Ab-PA | 90 | GD22627-PA | 1..90 | 1..90 | 396 | 92.2 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:41:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE18974-PA | 96 | GE18974-PA | 1..87 | 1..87 | 321 | 74.7 | Plus |