Clone IP02741 Report

Search the DGRC for IP02741

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:27
Well:41
Vector:pOT2
Associated Gene/TranscriptVm26Aa-RA
Protein status:IP02741.pep: gold
Preliminary Size:642
Sequenced Size:705

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9048 2005-01-01 Successful iPCR screen
Vm26Aa 2008-04-29 Release 5.5 accounting
Vm26Aa 2008-08-15 Release 5.9 accounting
Vm26Aa 2008-12-18 5.12 accounting

Clone Sequence Records

IP02741.complete Sequence

705 bp (705 high quality bases) assembled on 2006-04-13

GenBank Submission: BT025155

> IP02741.complete
CAGCAGCCCAACCAGCTCCCATCCGCCTCCAGCTCAATCTTCAACCACCA
ACAACCAAGATGAAATCCTTCGTGTGCATCGCTCTGGTCGCCTTCGCCGC
CGCCGCTCTGGCTTCGCCCACCAACGTGGCTTCGGCCACCGGCTCCACTG
GCTCCTCGGTGACCACCCAGGACGGAGAGCTGGAGGGAGTGACCGGACAG
GGATTCGGTGACCTGACCCGTCTCCGTAAGTCTGCCTACGGCGGCAGCTC
CGGCGGCTATGGCGGCTCCAGCATCCCAGCTCCTCCCTGCCCCAAGAACT
ACCTGTTCAGCTGCCAGCCCAACCTTGCCCCCGTGCCATGCAGCGCTCCA
GCTCCCAGCTACGGATCCGCCGGCGCCTACTCCTCCCCGGTGGCCACCTA
CGTCGCCCCCAACTACGGCGTGCCCCAGCACCAGCAGCAGCTGTACAGCG
CCTACGTGCCCCAGACCTATGGCTACCAGTACTAAGCACCTGCTCCGACT
GCGACTGCGATCATCGCCCAAGGACCACGAACCGACTGCCGAGAAACATA
AGCTTTGATGGATTTGACAAAAAATATACCCAAAAATATGTACTGCAATT
AAATCACTAAAAAAAAGCTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAA

IP02741.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:28:41
Subject Length Description Subject Range Query Range Score Percent Strand
Vm26Aa-RA 641 Vm26Aa-RA 23..641 1..619 3095 100 Plus
Vm34Ca-RA 491 Vm34Ca-RA 254..363 273..382 445 93.6 Plus
Vm26Ab-RA 625 Vm26Ab-RA 429..524 288..383 255 84.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:29:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 5958751..5959369 619..1 3095 100 Minus
chr2L 23010047 chr2L 13409931..13410040 382..273 445 93.6 Minus
chr2L 23010047 chr2L 5956483..5956578 288..383 255 84.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:35:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:29:38
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5959697..5960318 622..1 3110 100 Minus
2L 23513712 2L 13411269..13411378 382..273 445 93.6 Minus
2L 23513712 2L 5957432..5957527 288..383 255 84.4 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:19:50
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5959697..5960318 622..1 3110 100 Minus
2L 23513712 2L 13411269..13411378 382..273 445 93.6 Minus
2L 23513712 2L 5957432..5957527 288..383 255 84.3 Plus
Blast to na_te.dros performed on 2019-03-16 15:29:38 has no hits.

IP02741.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:30:34 Download gff for IP02741.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 5958751..5959369 1..619 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:18:45 Download gff for IP02741.complete
Subject Subject Range Query Range Percent Splice Strand
Vm26Aa-RA 1..426 60..485 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:51:00 Download gff for IP02741.complete
Subject Subject Range Query Range Percent Splice Strand
Vm26Aa-RA 1..426 60..485 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:46:38 Download gff for IP02741.complete
Subject Subject Range Query Range Percent Splice Strand
Vm26Aa-RA 1..426 60..485 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:31:41 Download gff for IP02741.complete
Subject Subject Range Query Range Percent Splice Strand
Vm26Aa-RA 1..426 60..485 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:47:26 Download gff for IP02741.complete
Subject Subject Range Query Range Percent Splice Strand
Vm26Aa-RA 1..426 60..485 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:24:46 Download gff for IP02741.complete
Subject Subject Range Query Range Percent Splice Strand
Vm26Aa-RA 23..641 1..619 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:51:00 Download gff for IP02741.complete
Subject Subject Range Query Range Percent Splice Strand
Vm26Aa-RA 23..641 1..619 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:46:38 Download gff for IP02741.complete
Subject Subject Range Query Range Percent Splice Strand
Vm26Aa-RA 23..641 1..619 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:31:41 Download gff for IP02741.complete
Subject Subject Range Query Range Percent Splice Strand
Vm26Aa-RA 23..641 1..619 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:47:26 Download gff for IP02741.complete
Subject Subject Range Query Range Percent Splice Strand
Vm26Aa-RA 23..641 1..619 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:30:34 Download gff for IP02741.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5959700..5960318 1..619 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:30:34 Download gff for IP02741.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5959700..5960318 1..619 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:30:34 Download gff for IP02741.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5959700..5960318 1..619 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:46:38 Download gff for IP02741.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5959700..5960318 1..619 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:10:12 Download gff for IP02741.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5959700..5960318 1..619 100   Minus

IP02741.hyp Sequence

Translation from 2 to 484

> IP02741.hyp
AAQPAPIRLQLNLQPPTTKMKSFVCIALVAFAAAALASPTNVASATGSTG
SSVTTQDGELEGVTGQGFGDLTRLRKSAYGGSSGGYGGSSIPAPPCPKNY
LFSCQPNLAPVPCSAPAPSYGSAGAYSSPVATYVAPNYGVPQHQQQLYSA
YVPQTYGYQY*

IP02741.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:53:13
Subject Length Description Subject Range Query Range Score Percent Strand
Vm26Aa-PB 141 CG9048-PB 1..141 20..160 746 100 Plus
Vm26Aa-PA 141 CG9048-PA 1..141 20..160 746 100 Plus
Vm34Ca-PA 119 CG9271-PA 69..112 90..133 218 88.6 Plus
Vm26Ab-PB 168 CG9046-PB 116..163 89..136 208 77.1 Plus
Vm26Ab-PA 168 CG9046-PA 116..163 89..136 208 77.1 Plus

IP02741.pep Sequence

Translation from 59 to 484

> IP02741.pep
MKSFVCIALVAFAAAALASPTNVASATGSTGSSVTTQDGELEGVTGQGFG
DLTRLRKSAYGGSSGGYGGSSIPAPPCPKNYLFSCQPNLAPVPCSAPAPS
YGSAGAYSSPVATYVAPNYGVPQHQQQLYSAYVPQTYGYQY*

IP02741.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:58:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14293-PA 147 GF14293-PA 1..147 1..141 483 86.4 Plus
Dana\GF21650-PA 118 GF21650-PA 68..105 71..108 196 100 Plus
Dana\GF15128-PA 105 GF15128-PA 13..76 59..126 187 58.8 Plus
Dana\GF15591-PA 163 GF15591-PA 113..158 72..117 185 80.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:58:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24269-PA 142 GG24269-PA 1..142 1..141 500 95.1 Plus
Dere\GG10199-PA 119 GG10199-PA 69..106 71..108 195 100 Plus
Dere\GG25107-PA 174 GG25107-PA 124..169 72..117 179 78.3 Plus
Dere\GG10317-PA 113 GG10317-PA 42..77 80..115 144 75 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:58:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10719-PA 144 GH10719-PA 1..144 1..141 398 66.7 Plus
Dgri\GH10720-PA 130 GH10720-PA 1..130 1..141 359 69.7 Plus
Dgri\GH11097-PA 106 GH11097-PA 56..101 71..116 190 84.8 Plus
Dgri\GH11015-PA 170 GH11015-PA 124..164 77..117 161 78 Plus
Dgri\GH24704-PA 692 GH24704-PA 634..687 43..95 144 55.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:07:19
Subject Length Description Subject Range Query Range Score Percent Strand
Vm26Aa-PB 141 CG9048-PB 1..141 1..141 746 100 Plus
Vm26Aa-PA 141 CG9048-PA 1..141 1..141 746 100 Plus
Vm34Ca-PA 119 CG9271-PA 69..112 71..114 218 88.6 Plus
Vm26Ab-PB 168 CG9046-PB 116..163 70..117 208 77.1 Plus
Vm26Ab-PA 168 CG9046-PA 116..163 70..117 208 77.1 Plus
Vm32E-PB 116 CG16874-PB 35..87 70..126 192 63.2 Plus
Vm32E-PA 116 CG16874-PA 35..87 70..126 192 63.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:58:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11326-PA 132 GI11326-PA 1..132 1..141 390 65.5 Plus
Dmoj\GI11336-PA 128 GI11336-PA 1..128 1..141 377 64.8 Plus
Dmoj\GI18220-PA 121 GI18220-PA 71..108 71..108 191 97.4 Plus
Dmoj\GI17534-PA 155 GI17534-PA 109..155 77..128 159 65.4 Plus
Dmoj\GI18145-PA 82 GI18145-PA 2..75 47..121 149 44.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:58:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19099-PA 147 GL19099-PA 1..147 1..141 442 75.5 Plus
Dper\GL25706-PA 132 GL25706-PA 82..119 71..108 194 100 Plus
Dper\GL19046-PA 95 GL19046-PA 11..89 41..117 187 54.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:58:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21503-PA 147 GA21503-PA 1..147 1..141 442 75.5 Plus
Dpse\GA25403-PA 132 GA25403-PA 82..119 71..108 194 100 Plus
Dpse\GA21661-PA 132 GA21661-PA 82..119 71..108 194 100 Plus
Dpse\GA21501-PA 177 GA21501-PA 126..171 72..117 186 80.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:58:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17983-PA 141 GM17983-PA 1..141 1..141 705 100 Plus
Dsec\GM25531-PA 119 GM25531-PA 69..106 71..108 195 100 Plus
Dsec\GM18584-PA 168 GM18584-PA 118..163 72..117 179 78.3 Plus
Dsec\GM11107-PA 118 GM11107-PA 35..89 70..126 159 62.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:58:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22620-PA 141 GD22620-PA 1..141 1..141 705 100 Plus
Dsim\GD23372-PA 168 GD23372-PA 118..163 72..117 179 78.3 Plus
Dsim\GD22183-PA 118 GD22183-PA 35..97 70..128 162 61.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:58:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12592-PA 133 GJ12592-PA 1..133 1..141 457 76.1 Plus
Dvir\GJ12581-PA 140 GJ12581-PA 35..140 34..141 386 84.4 Plus
Dvir\GJ18127-PA 121 GJ18127-PA 72..109 71..108 195 100 Plus
Dvir\GJ15426-PA 178 GJ15426-PA 127..172 72..117 177 76.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:58:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15410-PA 142 GK15410-PA 1..142 1..141 400 72.8 Plus
Dwil\GK15281-PA 111 GK15281-PA 60..98 71..108 184 97.4 Plus
Dwil\GK14709-PA 158 GK14709-PA 108..150 72..114 181 83.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:58:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18966-PA 141 GE18966-PA 1..141 1..141 521 93 Plus
Dyak\GE11602-PA 119 GE11602-PA 69..106 71..108 195 100 Plus
Dyak\GE25756-PA 167 GE25756-PA 117..162 72..117 179 78.3 Plus
Dyak\GE12948-PA 115 GE12948-PA 41..79 77..115 151 71.8 Plus