Clone IP02756 Report

Search the DGRC for IP02756

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:27
Well:56
Vector:pOT2
Associated Gene/TranscriptVm34Ca-RA
Protein status:IP02756.pep: gold
Preliminary Size:455
Sequenced Size:493

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9271 2005-01-01 Successful iPCR screen
Vm34Ca 2008-04-29 Release 5.5 accounting
Vm34Ca 2008-08-15 Release 5.9 accounting
Vm34Ca 2008-12-18 5.12 accounting

Clone Sequence Records

IP02756.complete Sequence

493 bp (493 high quality bases) assembled on 2005-03-01

GenBank Submission: BT023245

> IP02756.complete
AAATCATCAACCAATCAACATGAAGTGCATCGCCATCGTCTCCACCATCT
GCCTGCTGGCCGCTTTCGTTGCCGCCGATAAGGAGGATAAGATGCTCGGC
TCCTCGTACGGTGGTGGCTACGGCAAGCCCGCCGCTGCTCCGGCTCCATC
CTACTCCGCTCCGGCTGCCGCTCCCCAGGCCTACGCCGCCCCAGCTGCTC
CATCCTACGCCGCCGCTCCGGTCTCGATCCCGGCTCCTCCTTGCCCCAAG
AACTACCTGTTCAGCTGCCAGCCCAACCTGGCCCCAGTGCCATGCAGCGC
CCCAGCTCCCAGCTATGGATCCGCCGGTGCCTACTCGCAGTACGCCCCCG
TCTACGCTCCTCAGCCCATCCAGTGGTAGGATGATCCACAGACTTCACTA
ACCCCTGATCAACGACAAAAGCAATGCAGAAAAAAATAAAAGAAAAATAT
TTATGTTTAATCATAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP02756.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:54:06
Subject Length Description Subject Range Query Range Score Percent Strand
Vm34Ca-RA 491 Vm34Ca-RA 28..491 1..464 2320 100 Plus
Vm26Aa-RA 641 Vm26Aa-RA 295..404 227..336 445 93.6 Plus
Vm26Ab-RA 625 Vm26Ab-RA 400..531 213..344 300 81.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 20:08:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 13409803..13410266 464..1 2290 99.6 Minus
chr2L 23010047 chr2L 5958988..5959097 336..227 445 93.6 Minus
chr2L 23010047 chr2L 5956454..5956585 213..344 300 81.8 Plus
chr2L 23010047 chr2L 11170190..11170248 287..229 205 89.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:35:51 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 20:08:07
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13411137..13411604 468..1 2340 100 Minus
2L 23513712 2L 5959937..5960046 336..227 445 93.6 Minus
2L 23513712 2L 5957403..5957534 213..344 300 81.8 Plus
2L 23513712 2L 11171466..11171524 287..229 205 89.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:43:03
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 13411137..13411604 468..1 2340 100 Minus
2L 23513712 2L 5959937..5960046 336..227 445 93.6 Minus
2L 23513712 2L 5957403..5957534 213..344 300 81.8 Plus
2L 23513712 2L 11171466..11171524 287..229 205 89.8 Minus
Blast to na_te.dros performed on 2019-03-16 20:08:08 has no hits.

IP02756.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 20:09:12 Download gff for IP02756.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 13409803..13410266 1..464 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:18:52 Download gff for IP02756.complete
Subject Subject Range Query Range Percent Splice Strand
Vm34Ca-RA 1..360 20..379 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:26:35 Download gff for IP02756.complete
Subject Subject Range Query Range Percent Splice Strand
Vm34Ca-RA 1..360 20..379 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:51:51 Download gff for IP02756.complete
Subject Subject Range Query Range Percent Splice Strand
Vm34Ca-RA 1..360 20..379 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:10:38 Download gff for IP02756.complete
Subject Subject Range Query Range Percent Splice Strand
Vm34Ca-RA 1..360 20..379 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:53:06 Download gff for IP02756.complete
Subject Subject Range Query Range Percent Splice Strand
Vm34Ca-RA 1..360 20..379 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:29:30 Download gff for IP02756.complete
Subject Subject Range Query Range Percent Splice Strand
Vm34Ca-RA 28..455 1..428 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:26:35 Download gff for IP02756.complete
Subject Subject Range Query Range Percent Splice Strand
Vm34Ca-RA 28..455 1..428 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:51:51 Download gff for IP02756.complete
Subject Subject Range Query Range Percent Splice Strand
Vm34Ca-RA 13..476 1..464 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:10:38 Download gff for IP02756.complete
Subject Subject Range Query Range Percent Splice Strand
Vm34Ca-RA 28..455 1..428 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:53:06 Download gff for IP02756.complete
Subject Subject Range Query Range Percent Splice Strand
Vm34Ca-RA 28..491 1..464 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:09:12 Download gff for IP02756.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13411141..13411604 1..464 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:09:12 Download gff for IP02756.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13411141..13411604 1..464 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 20:09:12 Download gff for IP02756.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13411141..13411604 1..464 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:51:51 Download gff for IP02756.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 13411141..13411604 1..464 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:47:09 Download gff for IP02756.complete
Subject Subject Range Query Range Percent Splice Strand
2L 13411141..13411604 1..464 100   Minus

IP02756.hyp Sequence

Translation from 0 to 378

> IP02756.hyp
NHQPINMKCIAIVSTICLLAAFVAADKEDKMLGSSYGGGYGKPAAAPAPS
YSAPAAAPQAYAAPAAPSYAAAPVSIPAPPCPKNYLFSCQPNLAPVPCSA
PAPSYGSAGAYSQYAPVYAPQPIQW*

IP02756.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:53:36
Subject Length Description Subject Range Query Range Score Percent Strand
Vm34Ca-PA 119 CG9271-PA 1..119 7..125 638 100 Plus
Vm26Ab-PB 168 CG9046-PB 50..161 38..119 302 58.9 Plus
Vm26Ab-PA 168 CG9046-PA 50..161 38..119 302 58.9 Plus
Vm32E-PB 116 CG16874-PB 16..83 39..122 227 53.6 Plus
Vm32E-PA 116 CG16874-PA 16..83 39..122 227 53.6 Plus

IP02756.pep Sequence

Translation from 19 to 378

> IP02756.pep
MKCIAIVSTICLLAAFVAADKEDKMLGSSYGGGYGKPAAAPAPSYSAPAA
APQAYAAPAAPSYAAAPVSIPAPPCPKNYLFSCQPNLAPVPCSAPAPSYG
SAGAYSQYAPVYAPQPIQW*

IP02756.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:20:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21650-PA 118 GF21650-PA 1..118 1..119 314 81.5 Plus
Dana\GF15591-PA 163 GF15591-PA 113..156 70..113 198 88.6 Plus
Dana\GF14293-PA 147 GF14293-PA 77..113 70..106 176 94.6 Plus
Dana\GF15128-PA 105 GF15128-PA 26..72 70..116 165 68.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:20:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10199-PA 119 GG10199-PA 1..119 1..119 556 98.3 Plus
Dere\GG25107-PA 174 GG25107-PA 124..167 70..113 192 86.4 Plus
Dere\GG24269-PA 142 GG24269-PA 72..108 70..106 185 100 Plus
Dere\GG10317-PA 113 GG10317-PA 42..80 78..116 147 69.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:20:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11097-PA 106 GH11097-PA 1..106 1..119 304 64.7 Plus
Dgri\GH11015-PA 170 GH11015-PA 124..162 75..113 175 87.2 Plus
Dgri\GH10719-PA 144 GH10719-PA 76..112 70..106 171 89.2 Plus
Dgri\GH10720-PA 130 GH10720-PA 62..98 70..106 169 89.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:22:08
Subject Length Description Subject Range Query Range Score Percent Strand
Vm34Ca-PA 119 CG9271-PA 1..119 1..119 638 100 Plus
Vm26Ab-PB 168 CG9046-PB 50..161 32..113 302 58.9 Plus
Vm26Ab-PA 168 CG9046-PA 50..161 32..113 302 58.9 Plus
Vm32E-PB 116 CG16874-PB 16..83 33..116 227 53.6 Plus
Vm32E-PA 116 CG16874-PA 16..83 33..116 227 53.6 Plus
Vm26Aa-PB 141 CG9048-PB 71..114 69..112 218 88.6 Plus
Vm26Aa-PA 141 CG9048-PA 71..114 69..112 218 88.6 Plus
Vml-PB 578 CG34333-PB 488..573 27..93 149 40.7 Plus
Vml-PA 578 CG34333-PA 488..573 27..93 149 40.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:20:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18220-PA 121 GI18220-PA 1..121 1..119 357 70.2 Plus
Dmoj\GI17534-PA 155 GI17534-PA 109..147 75..113 172 84.6 Plus
Dmoj\GI11336-PA 128 GI11336-PA 58..94 70..106 169 86.5 Plus
Dmoj\GI11326-PA 132 GI11326-PA 62..98 70..106 169 86.5 Plus
Dmoj\GI18145-PA 82 GI18145-PA 23..69 70..113 143 61.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:20:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25706-PA 132 GL25706-PA 1..132 1..119 309 61.7 Plus
Dper\GL19046-PA 95 GL19046-PA 32..87 58..113 206 73.2 Plus
Dper\GL19099-PA 147 GL19099-PA 76..112 70..106 186 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:20:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25403-PA 132 GA25403-PA 1..132 1..119 309 60.9 Plus
Dpse\GA21661-PA 132 GA21661-PA 1..132 1..119 309 60.9 Plus
Dpse\GA21501-PA 177 GA21501-PA 126..169 70..113 198 88.6 Plus
Dpse\GA21503-PA 147 GA21503-PA 76..112 70..106 186 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:20:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25531-PA 119 GM25531-PA 1..119 1..119 557 98.3 Plus
Dsec\GM18584-PA 168 GM18584-PA 118..161 70..113 192 86.4 Plus
Dsec\GM17983-PA 141 GM17983-PA 72..108 70..106 187 100 Plus
Dsec\GM11107-PA 118 GM11107-PA 18..85 46..116 175 63.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:20:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23372-PA 168 GD23372-PA 118..161 70..113 192 86.4 Plus
Dsim\GD22620-PA 141 GD22620-PA 72..108 70..106 187 100 Plus
Dsim\GD22183-PA 118 GD22183-PA 38..85 71..116 156 68.8 Plus
Dsim\GD22059-PA 126 GD22059-PA 1..36 1..36 133 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:20:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18127-PA 121 GJ18127-PA 71..120 68..117 223 88 Plus
Dvir\GJ15426-PA 178 GJ15426-PA 127..170 70..113 187 81.8 Plus
Dvir\GJ12592-PA 133 GJ12592-PA 63..99 70..106 185 97.3 Plus
Dvir\GJ12581-PA 140 GJ12581-PA 70..106 70..106 182 97.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:20:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15281-PA 111 GK15281-PA 1..111 1..119 307 63.3 Plus
Dwil\GK14709-PA 158 GK14709-PA 108..152 70..114 201 88.9 Plus
Dwil\GK15410-PA 142 GK15410-PA 71..108 70..106 173 97.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:20:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11602-PA 119 GE11602-PA 1..119 1..119 560 99.2 Plus
Dyak\GE25756-PA 167 GE25756-PA 117..160 70..113 193 86.4 Plus
Dyak\GE18966-PA 141 GE18966-PA 71..107 70..106 182 97.3 Plus
Dyak\GE12948-PA 115 GE12948-PA 41..82 75..116 151 66.7 Plus