Clone IP02762 Report

Search the DGRC for IP02762

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:27
Well:62
Vector:pOT2
Associated Gene/TranscriptPGRP-SB1-RA
Protein status:IP02762.pep: gold
Preliminary Size:573
Sequenced Size:648

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9681 2005-01-01 Successful iPCR screen
PGRP-SB1 2008-04-29 Release 5.5 accounting
PGRP-SB1 2008-08-15 Release 5.9 accounting
PGRP-SB1 2008-12-18 5.12 accounting

Clone Sequence Records

IP02762.complete Sequence

648 bp assembled on 2006-11-09

GenBank Submission: BT023240

> IP02762.complete
CAAAGATGAACACATCAACGGCAATTAGTTTTGTGGCCGCTTTAGTGCTT
TGCTGCTTAGCTCTATCCGCCAATGCCCTGCAGATTGAACCACGCAGCAG
TTGGGGTGCGGTGTCTGCTCGATCGCCTTCTAGGATTTCCGGCGCCGTCG
ACTATGTGATCATCCATCATTCGGACAATCCTAATGGCTGCTCCACATCC
GAGCAGTGCAAGCGCATGATCAAGAACATTCAGTCGGATCACAAGGGTCG
CCGCAATTTCAGCGATATTGGATATAACTTTATCGTGGCCGGTGATGGCA
AGGTGTACGAGGGTCGTGGTTTCGGGCTCCAGGGATCACACTCCCCCAAC
TATAATCGCAAGAGCATTGGCATCGTCTTCATTGGCAACTTCGAACGCAG
TGCCCCATCCGCCCAGATGCTCCAGAACGCCAAGGATCTAATCGAGCTGG
CCAAGCAGCGTGGATACCTCAAGGATAACTACACGCTGTTCGGTCATCGG
CAGACCAAGGCCACCTCCTGCCCAGGTGATGCTCTGTACAACGAGATCAA
GACGTGGCCGCACTGGAGGCAAAACTAGAAAGCAAAGTTACATATCTTAA
GTAAAATAAACTTTTAAAAATTAAAAAAAAAAAAAAAAAAAAAAAAAA

IP02762.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:12:41
Subject Length Description Subject Range Query Range Score Percent Strand
PGRP-SB1-RA 767 PGRP-SB1-RA 132..755 1..624 3120 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:11:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16717012..16717575 622..59 2820 100 Minus
chr3L 24539361 chr3L 16717642..16717701 60..1 300 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:35:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:11:26
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16727297..16727862 624..59 2830 100 Minus
3L 28110227 3L 16727929..16727988 60..1 300 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:06:33
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16720397..16720962 624..59 2830 100 Minus
3L 28103327 3L 16721029..16721088 60..1 300 100 Minus
Blast to na_te.dros performed on 2019-03-16 10:11:27 has no hits.

IP02762.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:12:16 Download gff for IP02762.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16717012..16717573 61..622 100 <- Minus
chr3L 16717642..16717701 1..60 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:18:53 Download gff for IP02762.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-SB1-RA 1..573 6..578 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:20:11 Download gff for IP02762.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-SB1-RA 1..573 6..578 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:37:51 Download gff for IP02762.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-SB1-RA 1..573 6..578 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:37:03 Download gff for IP02762.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-SB1-RA 1..573 6..578 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:59:17 Download gff for IP02762.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-SB1-RA 1..573 6..578 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:48:28 Download gff for IP02762.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-SB1-RA 31..652 1..622 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:20:11 Download gff for IP02762.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-SB1-RA 31..652 1..622 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:37:51 Download gff for IP02762.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-SB1-RA 2..623 1..622 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:37:04 Download gff for IP02762.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-SB1-RA 31..652 1..622 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:59:17 Download gff for IP02762.complete
Subject Subject Range Query Range Percent Splice Strand
PGRP-SB1-RA 2..623 1..622 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:12:16 Download gff for IP02762.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16727299..16727860 61..622 100 <- Minus
3L 16727929..16727988 1..60 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:12:16 Download gff for IP02762.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16727299..16727860 61..622 100 <- Minus
3L 16727929..16727988 1..60 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:12:16 Download gff for IP02762.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16727299..16727860 61..622 100 <- Minus
3L 16727929..16727988 1..60 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:37:51 Download gff for IP02762.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16720399..16720960 61..622 100 <- Minus
arm_3L 16721029..16721088 1..60 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:49:17 Download gff for IP02762.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16720399..16720960 61..622 100 <- Minus
3L 16721029..16721088 1..60 100   Minus

IP02762.hyp Sequence

Translation from 2 to 577

> IP02762.hyp
KMNTSTAISFVAALVLCCLALSANALQIEPRSSWGAVSARSPSRISGAVD
YVIIHHSDNPNGCSTSEQCKRMIKNIQSDHKGRRNFSDIGYNFIVAGDGK
VYEGRGFGLQGSHSPNYNRKSIGIVFIGNFERSAPSAQMLQNAKDLIELA
KQRGYLKDNYTLFGHRQTKATSCPGDALYNEIKTWPHWRQN*

IP02762.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:53:42
Subject Length Description Subject Range Query Range Score Percent Strand
PGRP-SB1-PA 190 CG9681-PA 1..190 2..191 1009 100 Plus
PGRP-SB2-PA 182 CG9697-PA 6..179 13..189 456 52 Plus
PGRP-SC2-PA 184 CG14745-PA 5..183 13..189 395 41.1 Plus
PGRP-LB-PF 215 CG14704-PF 18..175 31..188 393 44.9 Plus
PGRP-LB-PE 215 CG14704-PE 18..175 31..188 393 44.9 Plus

IP02762.pep Sequence

Translation from 5 to 577

> IP02762.pep
MNTSTAISFVAALVLCCLALSANALQIEPRSSWGAVSARSPSRISGAVDY
VIIHHSDNPNGCSTSEQCKRMIKNIQSDHKGRRNFSDIGYNFIVAGDGKV
YEGRGFGLQGSHSPNYNRKSIGIVFIGNFERSAPSAQMLQNAKDLIELAK
QRGYLKDNYTLFGHRQTKATSCPGDALYNEIKTWPHWRQN*

IP02762.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:40:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10506-PA 187 GF10506-PA 1..186 1..189 884 85.7 Plus
Dana\GF23927-PA 182 GF23927-PA 3..181 13..190 461 50 Plus
Dana\GF16643-PA 226 GF16643-PA 34..193 30..189 413 44.4 Plus
Dana\GF12377-PA 185 GF12377-PA 2..183 7..187 378 39.3 Plus
Dana\GF21644-PA 185 GF21644-PA 2..183 7..187 378 39.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:40:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15854-PA 190 GG15854-PA 1..190 1..190 969 94.2 Plus
Dere\GG13574-PA 182 GG13574-PA 6..179 12..188 473 52 Plus
Dere\GG17219-PA 306 GG17219-PA 109..266 30..187 408 44.9 Plus
Dere\GG23381-PA 184 GG23381-PA 5..183 12..188 403 42.2 Plus
Dere\GG23379-PA 185 GG23379-PA 2..183 7..187 381 39.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:40:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15225-PA 191 GH15225-PA 1..190 1..189 849 81.2 Plus
Dgri\GH21354-PA 184 GH21354-PA 5..183 12..188 429 42.8 Plus
Dgri\GH15357-PA 218 GH15357-PA 35..198 26..189 427 46.3 Plus
Dgri\GH21355-PA 184 GH21355-PA 5..183 12..188 422 41.7 Plus
Dgri\GH20540-PA 184 GH20540-PA 2..183 3..188 415 41.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:42:52
Subject Length Description Subject Range Query Range Score Percent Strand
PGRP-SB1-PA 190 CG9681-PA 1..190 1..190 1009 100 Plus
PGRP-SB2-PA 182 CG9697-PA 6..179 12..188 456 52 Plus
PGRP-SC2-PA 184 CG14745-PA 5..183 12..188 395 41.1 Plus
PGRP-LB-PF 215 CG14704-PF 18..175 30..187 393 44.9 Plus
PGRP-LB-PE 215 CG14704-PE 18..175 30..187 393 44.9 Plus
PGRP-LB-PA 215 CG14704-PA 18..175 30..187 393 44.9 Plus
PGRP-LB-PB 215 CG14704-PB 18..175 30..187 393 44.9 Plus
PGRP-LB-PC 232 CG14704-PC 35..192 30..187 393 44.9 Plus
PGRP-LB-PD 255 CG14704-PD 58..215 30..187 393 44.9 Plus
PGRP-SC1b-PB 185 CG8577-PB 2..183 7..187 369 38.8 Plus
PGRP-SC1b-PA 185 CG8577-PA 2..183 7..187 369 38.8 Plus
PGRP-SC1a-PA 185 CG14746-PA 2..183 7..187 369 38.8 Plus
PGRP-SA-PB 203 CG11709-PB 35..202 22..190 346 40.8 Plus
PGRP-SA-PA 203 CG11709-PA 35..202 22..190 346 40.8 Plus
PGRP-LC-PE 329 CG4432-PE 187..325 48..187 318 43.6 Plus
PGRP-LC-PD 500 CG4432-PD 358..496 48..187 318 43.6 Plus
PGRP-LC-PA 500 CG4432-PA 358..496 48..187 318 43.6 Plus
PGRP-SD-PA 186 CG7496-PA 6..184 15..189 313 37.6 Plus
PGRP-LC-PJ 340 CG4432-PJ 172..326 33..187 295 39.1 Plus
PGRP-LC-PC 511 CG4432-PC 343..497 33..187 295 39.1 Plus
PGRP-LE-PB 345 CG8995-PB 177..337 27..187 289 38.9 Plus
PGRP-LE-PA 345 CG8995-PA 177..337 27..187 289 38.9 Plus
PGRP-SB2-PB 191 CG9697-PB 6..123 12..132 287 50.4 Plus
PGRP-LF-PA 369 CG4437-PA 57..222 25..190 279 35.3 Plus
PGRP-LC-PK 330 CG4432-PK 189..329 51..187 200 31.9 Plus
PGRP-LC-PI 501 CG4432-PI 360..500 51..187 200 31.9 Plus
PGRP-LC-PH 520 CG4432-PH 379..519 51..187 200 31.9 Plus
PGRP-LC-PB 520 CG4432-PB 379..519 51..187 200 31.9 Plus
PGRP-LA-PF 299 CG32042-PF 110..273 23..187 185 28 Plus
PGRP-LA-PE 368 CG32042-PE 179..342 23..187 185 28 Plus
PGRP-LA-PG 138 CG32042-PG 1..112 72..187 165 30.2 Plus
PGRP-LA-PC 138 CG32042-PC 1..112 72..187 165 30.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:40:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11935-PA 191 GI11935-PA 1..190 1..189 847 81.7 Plus
Dmoj\GI20770-PA 184 GI20770-PA 6..183 9..188 451 44.4 Plus
Dmoj\GI22456-PA 212 GI22456-PA 30..198 21..189 429 45 Plus
Dmoj\GI18809-PA 184 GI18809-PA 5..183 12..188 407 42.2 Plus
Dmoj\GI18808-PA 187 GI18808-PA 1..186 1..188 381 38.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:40:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13224-PA 144 GL13224-PA 2..141 5..143 619 82.1 Plus
Dper\GL12268-PA 310 GL12268-PA 84..279 2..187 407 38.2 Plus
Dper\GL13286-PA 130 GL13286-PA 2..127 62..188 397 53.5 Plus
Dper\GL17120-PA 185 GL17120-PA 2..183 7..187 362 37.7 Plus
Dper\GL17117-PA 185 GL17117-PA 2..183 7..187 362 37.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:40:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21961-PA 188 GA21961-PA 2..186 5..188 834 82.2 Plus
Dpse\GA21970-PA 182 GA21970-PA 18..179 26..188 439 49.1 Plus
Dpse\GA13217-PA 184 GA13217-PA 5..183 12..188 420 42.8 Plus
Dpse\GA13189-PA 225 GA13189-PA 37..194 30..187 407 43.7 Plus
Dpse\GA24974-PA 185 GA24974-PA 2..183 7..187 362 37.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:40:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24370-PA 190 GM24370-PA 1..190 1..190 1008 97.4 Plus
Dsec\GM25654-PA 182 GM25654-PA 6..179 12..188 474 52 Plus
Dsec\GM26096-PA 232 GM26096-PA 35..192 30..187 408 44.9 Plus
Dsec\GM21060-PA 185 GM21060-PA 2..183 7..187 375 39.3 Plus
Dsec\GM21059-PA 185 GM21059-PA 2..183 7..187 371 38.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:40:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\PGRP-SB1-PA 190 GD12445-PA 1..190 1..190 1009 97.9 Plus
Dsim\PGRP-SB2-PA 182 GD14659-PA 5..179 11..188 476 51.7 Plus
Dsim\GD15111-PA 295 GD15111-PA 98..255 30..187 410 44.9 Plus
Dsim\PGRP-SC2-PA 184 GD10595-PA 5..183 12..188 408 41.7 Plus
Dsim\PGRP-SC1a-PA 185 GD10593-PA 2..183 7..187 372 38.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:40:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12160-PA 191 GJ12160-PA 1..190 1..189 840 80.6 Plus
Dvir\GJ20505-PA 184 GJ20505-PA 5..183 12..188 426 42.8 Plus
Dvir\GJ10054-PA 214 GJ10054-PA 37..200 26..189 421 45.1 Plus
Dvir\GJ21836-PA 184 GJ21836-PA 7..183 9..188 418 42.2 Plus
Dvir\GJ21835-PA 187 GJ21835-PA 6..186 10..188 390 41.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:40:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17343-PA 192 GK17343-PA 10..190 8..188 828 83.4 Plus
Dwil\GK17119-PA 173 GK17119-PA 1..172 18..190 471 51.4 Plus
Dwil\GK11791-PA 212 GK11791-PA 35..192 30..187 418 46.2 Plus
Dwil\GK21737-PA 185 GK21737-PA 3..184 4..188 411 40.5 Plus
Dwil\GK21567-PA 187 GK21567-PA 1..185 1..187 370 36.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:40:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22193-PA 190 GE22193-PA 1..190 1..190 967 93.7 Plus
Dyak\GE19871-PA 184 GE19871-PA 20..181 26..188 455 52.1 Plus
Dyak\GE19223-PA 184 GE19223-PA 5..183 12..188 408 42.2 Plus
Dyak\GE24618-PA 233 GE24618-PA 35..192 30..187 408 44.3 Plus
Dyak\GE19222-PA 185 GE19222-PA 2..183 7..187 372 38.8 Plus