Clone IP02765 Report

Search the DGRC for IP02765

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:27
Well:65
Vector:pOT2
Associated Gene/TranscriptmRpS18C-RA
Protein status:IP02765.pep: gold
Preliminary Size:423
Sequenced Size:548

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9688 2005-01-01 Successful iPCR screen
mRpS18C 2008-04-29 Release 5.5 accounting
mRpS18C 2008-08-15 Release 5.9 accounting
mRpS18C 2008-12-18 5.12 accounting

Clone Sequence Records

IP02765.complete Sequence

548 bp (548 high quality bases) assembled on 2005-03-01

GenBank Submission: BT023241

> IP02765.complete
ATAACACGAGGTAAATATTGGAAATAAAAATATTTAGCATGTTGAAATTA
GGAAAGTTTCTGGCACAAAATGCCACGTTGGTCAATCTGGTGGGCAGACA
GCAGCTGGGAACCGTCAGCCGCCTCTATTCAGCTGCCCCGGAGTCGTCCG
ACTTGGATCTGCCGATCGACATAAAGAATCCCTATGAAAAGGACCCCCAG
CAGTGCATCCTATGCAAGCACAGCATCGAGCCGCACTACAAGAACGTGAA
GCTGCTCTCCCAATTCCAATCGCCATACACGGGTCGCATTTACGGGCGTC
ACATCACCGGATTATGCAAGCGCCGGCAGGAGCAAGTGGAGCAGGCCATT
CTGCGTGCCCAGCAGTGCCTGCTGATGCCGGGATACCACAAGGACCTCGA
CTTCCTGCAGGACCCCAAGCTCTTTGATCCCGAGCGGCCCGTTCGCCCAC
ACAAGTACTAGTTTTCTGATAACTTTTAGTTTCCTCTTTGTTGCAATGGG
AATATAGAGTTTCTTAATGTTAAATCTTAAAAAAAAAAAAAAAAAAAA

IP02765.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:54:06
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS18C-RA 643 mRpS18C-RA 43..573 1..531 2655 100 Plus
CG15536-RA 664 CG15536-RA 604..664 531..471 305 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 15:33:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 26246651..26247107 72..528 2285 100 Plus
chr3R 27901430 chr3R 26246525..26246596 1..72 360 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:35:55 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 15:33:17
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 30424100..30424559 72..531 2300 100 Plus
3R 32079331 3R 30423974..30424045 1..72 360 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:43:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 30164931..30165390 72..531 2300 100 Plus
3R 31820162 3R 30164805..30164876 1..72 360 100 Plus
Blast to na_te.dros performed on 2019-03-16 15:33:17 has no hits.

IP02765.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 15:34:10 Download gff for IP02765.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 26246525..26246596 1..72 100 -> Plus
chr3R 26246652..26247107 73..528 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:18:55 Download gff for IP02765.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS18C-RA 1..423 39..461 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:26:37 Download gff for IP02765.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS18C-RA 1..423 39..461 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:48:14 Download gff for IP02765.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS18C-RA 1..423 39..461 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:10:41 Download gff for IP02765.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS18C-RA 1..423 39..461 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:48:58 Download gff for IP02765.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS18C-RA 1..423 39..461 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:29:31 Download gff for IP02765.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS18C-RA 1..423 39..461 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:26:37 Download gff for IP02765.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS18C-RA 1..528 1..528 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:48:14 Download gff for IP02765.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS18C-RA 1..528 1..528 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:10:41 Download gff for IP02765.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS18C-RA 1..423 39..461 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:48:58 Download gff for IP02765.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS18C-RA 1..528 1..528 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:34:10 Download gff for IP02765.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30424101..30424556 73..528 100   Plus
3R 30423974..30424045 1..72 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:34:10 Download gff for IP02765.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30424101..30424556 73..528 100   Plus
3R 30423974..30424045 1..72 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 15:34:10 Download gff for IP02765.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30424101..30424556 73..528 100   Plus
3R 30423974..30424045 1..72 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:48:14 Download gff for IP02765.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 26249696..26249767 1..72 100 -> Plus
arm_3R 26249823..26250278 73..528 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:47:10 Download gff for IP02765.complete
Subject Subject Range Query Range Percent Splice Strand
3R 30164932..30165387 73..528 100   Plus
3R 30164805..30164876 1..72 100 -> Plus

IP02765.hyp Sequence

Translation from 38 to 460

> IP02765.hyp
MLKLGKFLAQNATLVNLVGRQQLGTVSRLYSAAPESSDLDLPIDIKNPYE
KDPQQCILCKHSIEPHYKNVKLLSQFQSPYTGRIYGRHITGLCKRRQEQV
EQAILRAQQCLLMPGYHKDLDFLQDPKLFDPERPVRPHKY*

IP02765.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:53:48
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS18C-PA 140 CG9688-PA 1..140 1..140 745 100 Plus

IP02765.pep Sequence

Translation from 38 to 460

> IP02765.pep
MLKLGKFLAQNATLVNLVGRQQLGTVSRLYSAAPESSDLDLPIDIKNPYE
KDPQQCILCKHSIEPHYKNVKLLSQFQSPYTGRIYGRHITGLCKRRQEQV
EQAILRAQQCLLMPGYHKDLDFLQDPKLFDPERPVRPHKY*

IP02765.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:20:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18834-PA 140 GF18834-PA 1..140 1..140 615 80 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:20:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11748-PA 140 GG11748-PA 1..140 1..140 697 93.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:20:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14032-PA 357 GH14032-PA 254..357 37..140 497 80.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:16:57
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS18C-PA 140 CG9688-PA 1..140 1..140 745 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:20:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24853-PA 147 GI24853-PA 1..147 1..140 535 69.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:20:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13456-PA 137 GL13456-PA 3..137 12..140 521 72.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:20:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21965-PB 146 GA21965-PB 1..146 1..140 567 72.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:20:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12877-PA 140 GM12877-PA 1..140 1..140 726 97.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:20:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21516-PA 140 GD21516-PA 1..140 1..140 727 97.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:20:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24497-PA 147 GJ24497-PA 1..147 1..140 529 68.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:20:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14131-PA 143 GK14131-PA 1..143 1..140 560 72.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:20:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10875-PA 140 GE10875-PA 1..140 1..140 720 97.1 Plus