BDGP Sequence Production Resources |
Search the DGRC for IP02765
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 27 |
Well: | 65 |
Vector: | pOT2 |
Associated Gene/Transcript | mRpS18C-RA |
Protein status: | IP02765.pep: gold |
Preliminary Size: | 423 |
Sequenced Size: | 548 |
Gene | Date | Evidence |
---|---|---|
CG9688 | 2005-01-01 | Successful iPCR screen |
mRpS18C | 2008-04-29 | Release 5.5 accounting |
mRpS18C | 2008-08-15 | Release 5.9 accounting |
mRpS18C | 2008-12-18 | 5.12 accounting |
548 bp (548 high quality bases) assembled on 2005-03-01
GenBank Submission: BT023241
> IP02765.complete ATAACACGAGGTAAATATTGGAAATAAAAATATTTAGCATGTTGAAATTA GGAAAGTTTCTGGCACAAAATGCCACGTTGGTCAATCTGGTGGGCAGACA GCAGCTGGGAACCGTCAGCCGCCTCTATTCAGCTGCCCCGGAGTCGTCCG ACTTGGATCTGCCGATCGACATAAAGAATCCCTATGAAAAGGACCCCCAG CAGTGCATCCTATGCAAGCACAGCATCGAGCCGCACTACAAGAACGTGAA GCTGCTCTCCCAATTCCAATCGCCATACACGGGTCGCATTTACGGGCGTC ACATCACCGGATTATGCAAGCGCCGGCAGGAGCAAGTGGAGCAGGCCATT CTGCGTGCCCAGCAGTGCCTGCTGATGCCGGGATACCACAAGGACCTCGA CTTCCTGCAGGACCCCAAGCTCTTTGATCCCGAGCGGCCCGTTCGCCCAC ACAAGTACTAGTTTTCTGATAACTTTTAGTTTCCTCTTTGTTGCAATGGG AATATAGAGTTTCTTAATGTTAAATCTTAAAAAAAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 26246525..26246596 | 1..72 | 100 | -> | Plus |
chr3R | 26246652..26247107 | 73..528 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS18C-RA | 1..423 | 39..461 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS18C-RA | 1..423 | 39..461 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS18C-RA | 1..423 | 39..461 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS18C-RA | 1..423 | 39..461 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS18C-RA | 1..423 | 39..461 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS18C-RA | 1..423 | 39..461 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS18C-RA | 1..528 | 1..528 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS18C-RA | 1..528 | 1..528 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS18C-RA | 1..423 | 39..461 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS18C-RA | 1..528 | 1..528 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 30424101..30424556 | 73..528 | 100 | Plus | |
3R | 30423974..30424045 | 1..72 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 30424101..30424556 | 73..528 | 100 | Plus | |
3R | 30423974..30424045 | 1..72 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 30424101..30424556 | 73..528 | 100 | Plus | |
3R | 30423974..30424045 | 1..72 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 26249696..26249767 | 1..72 | 100 | -> | Plus |
arm_3R | 26249823..26250278 | 73..528 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 30164932..30165387 | 73..528 | 100 | Plus | |
3R | 30164805..30164876 | 1..72 | 100 | -> | Plus |
Translation from 38 to 460
> IP02765.hyp MLKLGKFLAQNATLVNLVGRQQLGTVSRLYSAAPESSDLDLPIDIKNPYE KDPQQCILCKHSIEPHYKNVKLLSQFQSPYTGRIYGRHITGLCKRRQEQV EQAILRAQQCLLMPGYHKDLDFLQDPKLFDPERPVRPHKY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpS18C-PA | 140 | CG9688-PA | 1..140 | 1..140 | 745 | 100 | Plus |
Translation from 38 to 460
> IP02765.pep MLKLGKFLAQNATLVNLVGRQQLGTVSRLYSAAPESSDLDLPIDIKNPYE KDPQQCILCKHSIEPHYKNVKLLSQFQSPYTGRIYGRHITGLCKRRQEQV EQAILRAQQCLLMPGYHKDLDFLQDPKLFDPERPVRPHKY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF18834-PA | 140 | GF18834-PA | 1..140 | 1..140 | 615 | 80 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG11748-PA | 140 | GG11748-PA | 1..140 | 1..140 | 697 | 93.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14032-PA | 357 | GH14032-PA | 254..357 | 37..140 | 497 | 80.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpS18C-PA | 140 | CG9688-PA | 1..140 | 1..140 | 745 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI24853-PA | 147 | GI24853-PA | 1..147 | 1..140 | 535 | 69.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL13456-PA | 137 | GL13456-PA | 3..137 | 12..140 | 521 | 72.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA21965-PB | 146 | GA21965-PB | 1..146 | 1..140 | 567 | 72.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM12877-PA | 140 | GM12877-PA | 1..140 | 1..140 | 726 | 97.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD21516-PA | 140 | GD21516-PA | 1..140 | 1..140 | 727 | 97.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ24497-PA | 147 | GJ24497-PA | 1..147 | 1..140 | 529 | 68.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK14131-PA | 143 | GK14131-PA | 1..143 | 1..140 | 560 | 72.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE10875-PA | 140 | GE10875-PA | 1..140 | 1..140 | 720 | 97.1 | Plus |