Clone IP02782 Report

Search the DGRC for IP02782

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:27
Well:82
Vector:pOT2
Associated Gene/TranscriptLectin-galC1-RA
Protein status:IP02782.pep: gold
Preliminary Size:763
Sequenced Size:709

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9976 2005-01-01 Successful iPCR screen
Lectin-galC1 2008-04-29 Release 5.5 accounting
Lectin-galC1 2008-08-15 Release 5.9 accounting
Lectin-galC1 2008-12-18 5.12 accounting

Clone Sequence Records

IP02782.complete Sequence

709 bp (709 high quality bases) assembled on 2006-01-20

GenBank Submission: BT024424

> IP02782.complete
AAATGCTGAAGCTTACGGTTCTACTAATTACATTGCTGGTCATAGCAAAA
ACTGGATGGACTCGCGAAAAGTTCTCCATACAAGTAAACGAAGGAAATAC
GTTTGGTGCGCTCGTCAAGGCGGAACCCTTTACCAAAATCAACGACGGAT
ACTACTTCTTTGGCACGGAGTCCTTGAACTGGTACGAGGCCTACGAGAAA
TGCCGCGAATTGAACTCTGAGCTGGTCACATTCGAAACGGACCAGGAGTT
CGATGCCGTTACGGCTTTCCTGACGGCCAACGGATCACGGCTGACGTACT
GGACATCGGGAAACGATCTGGCCAAGACTGGCAGCCACAGATGGTTCACC
AATGCCCAGCGAATTAGTTCGCTCAGGTGGGCAAGGAATCAGCCGGATAA
TGCTGGGCAGAAGGAGCACTGCATCCACCTTGGCTATATTTACAAGGACT
CGCGGAAGTTTGAGCTAAACGATAGACCCTGCTCACAGGATCCAAACAGT
TTGTTTAAGTATATATGCGAAGCTCCCGAAATGGAAACCATTTCCATTGT
GGTGTGGAAGTAGAGTACTTCACAAACCTCTTCCATTTCAGAAGTTTGAC
TTTATAGTTTTGCAATGAAGGGGAACCACCGGAATACTATTTTCTTGAGC
AGCCATAAAATAAATTAAAAGGTTTTGTATTTTTCTAAGATAAAAAAAAA
AAAAAAAAA

IP02782.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:18:48
Subject Length Description Subject Range Query Range Score Percent Strand
Lectin-galC1-RA 838 Lectin-galC1-RA 78..770 1..693 3465 100 Plus
Lectin-galC1-RB 838 Lectin-galC1-RB 78..770 1..693 3465 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:24:42
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 19416154..19416753 92..691 3000 100 Plus
chr2L 23010047 chr2L 19415994..19416091 1..98 475 99 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:35:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:24:40
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19417618..19418219 92..693 3010 100 Plus
2L 23513712 2L 19417458..19417555 1..98 475 99 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:11:49
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19417618..19418219 92..693 3010 100 Plus
2L 23513712 2L 19417458..19417555 1..98 475 98.9 Plus
Blast to na_te.dros performed on 2019-03-15 19:24:41 has no hits.

IP02782.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:25:34 Download gff for IP02782.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 19415994..19416086 1..93 100 -> Plus
chr2L 19416156..19416753 94..691 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:18:57 Download gff for IP02782.complete
Subject Subject Range Query Range Percent Splice Strand
Lectin-galC1-RA 1..561 3..563 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:32:56 Download gff for IP02782.complete
Subject Subject Range Query Range Percent Splice Strand
Lectin-galC1-RB 1..561 3..563 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:50:34 Download gff for IP02782.complete
Subject Subject Range Query Range Percent Splice Strand
Lectin-galC1-RA 1..561 3..563 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:06:58 Download gff for IP02782.complete
Subject Subject Range Query Range Percent Splice Strand
Lectin-galC1-RA 1..561 3..563 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:17:27 Download gff for IP02782.complete
Subject Subject Range Query Range Percent Splice Strand
Lectin-galC1-RA 1..561 3..563 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:04:22 Download gff for IP02782.complete
Subject Subject Range Query Range Percent Splice Strand
Lectin-galC1-RA 12..702 1..691 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:32:56 Download gff for IP02782.complete
Subject Subject Range Query Range Percent Splice Strand
Lectin-galC1-RA 12..702 1..691 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:50:34 Download gff for IP02782.complete
Subject Subject Range Query Range Percent Splice Strand
Lectin-galC1-RA 12..702 1..691 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:06:58 Download gff for IP02782.complete
Subject Subject Range Query Range Percent Splice Strand
Lectin-galC1-RA 12..702 1..691 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:17:27 Download gff for IP02782.complete
Subject Subject Range Query Range Percent Splice Strand
Lectin-galC1-RA 12..702 1..691 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:25:34 Download gff for IP02782.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19417458..19417550 1..93 100 -> Plus
2L 19417620..19418217 94..691 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:25:34 Download gff for IP02782.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19417458..19417550 1..93 100 -> Plus
2L 19417620..19418217 94..691 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:25:34 Download gff for IP02782.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19417458..19417550 1..93 100 -> Plus
2L 19417620..19418217 94..691 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:50:34 Download gff for IP02782.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19417458..19417550 1..93 100 -> Plus
arm_2L 19417620..19418217 94..691 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:57:32 Download gff for IP02782.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19417458..19417550 1..93 100 -> Plus
2L 19417620..19418217 94..691 100   Plus

IP02782.pep Sequence

Translation from 2 to 562

> IP02782.pep
MLKLTVLLITLLVIAKTGWTREKFSIQVNEGNTFGALVKAEPFTKINDGY
YFFGTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLTYW
TSGNDLAKTGSHRWFTNAQRISSLRWARNQPDNAGQKEHCIHLGYIYKDS
RKFELNDRPCSQDPNSLFKYICEAPEMETISIVVWK*

IP02782.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:36:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14718-PA 186 GF14718-PA 1..186 1..186 757 72 Plus
Dana\GF14041-PA 265 GF14041-PA 110..265 31..186 545 60.9 Plus
Dana\GF22005-PA 278 GF22005-PA 125..278 29..185 297 43.2 Plus
Dana\GF14041-PA 265 GF14041-PA 1..110 1..107 253 42.7 Plus
Dana\GF22005-PA 278 GF22005-PA 1..129 1..133 232 38.1 Plus
Dana\GF21983-PA 128 GF21983-PA 16..125 36..144 219 40 Plus
Dana\GF21734-PA 194 GF21734-PA 43..186 32..179 209 30.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:36:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21174-PA 186 GG21174-PA 14..186 14..186 831 85.5 Plus
Dere\GG21175-PA 186 GG21175-PA 1..186 1..186 591 57 Plus
Dere\GG19039-PA 188 GG19039-PA 37..180 32..179 200 28.8 Plus
Dere\GG12225-PA 134 GG12225-PA 3..133 43..178 157 33.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:36:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19636-PA 174 GH19636-PA 1..160 1..167 211 30.2 Plus
Dgri\GH24460-PA 195 GH24460-PA 9..194 7..186 204 26.2 Plus
Dgri\GH10464-PA 197 GH10464-PA 70..194 40..174 174 30.9 Plus
Dgri\GH13620-PA 176 GH13620-PA 36..165 38..173 168 26.8 Plus
Dgri\GH11271-PA 376 GH11271-PA 245..371 39..173 160 32.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:13:01
Subject Length Description Subject Range Query Range Score Percent Strand
Lectin-galC1-PB 186 CG9976-PB 1..186 1..186 999 100 Plus
Lectin-galC1-PA 186 CG9976-PA 1..186 1..186 999 100 Plus
lectin-37Da-PB 186 CG33532-PB 1..186 1..186 592 57.5 Plus
lectin-37Da-PA 186 CG33532-PA 1..186 1..186 592 57.5 Plus
CG43055-PA 180 CG43055-PA 22..180 23..185 321 39.8 Plus
Sfp24F-PA 175 CG42468-PA 18..165 24..173 252 34.9 Plus
Sfp24F-PB 175 CG42468-PB 18..165 24..173 252 34.9 Plus
CG12111-PB 188 CG12111-PB 43..187 38..186 204 29.2 Plus
CG12111-PA 188 CG12111-PA 43..187 38..186 204 29.2 Plus
lectin-37Db-PB 150 CG33533-PB 30..148 45..173 148 27.1 Plus
lectin-37Db-PA 150 CG33533-PA 30..148 45..173 148 27.1 Plus
tfc-PC 188 CG9134-PC 53..184 42..173 148 26.8 Plus
tfc-PA 188 CG9134-PA 53..184 42..173 148 26.8 Plus
tfc-PB 376 CG9134-PB 241..372 42..173 148 26.8 Plus
CG15358-PE 252 CG15358-PE 119..251 34..167 147 29.2 Plus
CG15358-PD 252 CG15358-PD 119..251 34..167 147 29.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:36:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14863-PA 171 GI14863-PA 27..171 38..185 303 39.6 Plus
Dmoj\GI13595-PA 110 GI13595-PA 1..110 70..185 205 36.2 Plus
Dmoj\GI14792-PA 194 GI14792-PA 43..186 32..179 201 29.4 Plus
Dmoj\GI24801-PA 174 GI24801-PA 41..171 43..181 175 28.8 Plus
Dmoj\GI14022-PA 161 GI14022-PA 30..155 36..173 171 32.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:36:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21206-PA 186 GL21206-PA 1..186 1..186 743 69.4 Plus
Dper\GL19105-PA 171 GL19105-PA 26..171 38..185 285 39.5 Plus
Dper\GL26241-PA 180 GL26241-PA 25..180 27..185 271 35.2 Plus
Dper\GL14647-PA 194 GL14647-PA 43..187 32..180 197 27.9 Plus
Dper\GL26705-PA 277 GL26705-PA 154..276 43..173 189 36.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:36:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22161-PA 186 GA22161-PA 1..186 1..186 743 69.4 Plus
Dpse\GA28093-PA 180 GA28093-PA 25..180 27..185 283 37.2 Plus
Dpse\GA11405-PA 194 GA11405-PA 43..186 32..179 198 28.8 Plus
Dpse\GA29024-PA 277 GA29024-PA 154..276 43..173 189 36.4 Plus
Dpse\GA26690-PA 396 GA26690-PA 287..395 50..173 163 35.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:36:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17341-PA 186 GM17341-PA 1..186 1..186 971 96.2 Plus
Dsec\GM17342-PA 186 GM17342-PA 1..186 1..186 597 57.5 Plus
Dsec\GM10799-PA 184 GM10799-PA 1..184 1..186 538 55.9 Plus
Dsec\GM18119-PA 291 GM18119-PA 170..269 43..144 144 29.1 Plus
Dsec\GM16582-PA 268 GM16582-PA 144..267 43..167 140 31.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:36:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Lectin-galC1-PA 186 GD24200-PA 1..186 1..186 953 94.1 Plus
Dsim\GD24201-PA 186 GD24201-PA 1..186 1..186 612 59.7 Plus
Dsim\GD19773-PA 184 GD19773-PA 1..184 1..186 539 55.4 Plus
Dsim\GD24567-PA 188 GD24567-PA 37..180 32..179 206 29.4 Plus
Dsim\GD22727-PA 291 GD22727-PA 170..268 43..143 143 29.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:36:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24063-PA 173 GJ24063-PA 1..161 1..169 230 31 Plus
Dvir\GJ18331-PA 123 GJ18331-PA 4..118 50..174 222 40 Plus
Dvir\GJ16447-PA 189 GJ16447-PA 64..186 41..174 215 35.6 Plus
Dvir\GJ19459-PA 194 GJ19459-PA 43..186 32..179 200 29.4 Plus
Dvir\GJ16497-PA 252 GJ16497-PA 126..248 43..174 193 32.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:36:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23835-PA 187 GK23835-PA 1..187 1..186 562 56.1 Plus
Dwil\GK23836-PA 283 GK23836-PA 135..283 38..186 561 67.1 Plus
Dwil\GK23834-PA 184 GK23834-PA 7..184 4..186 499 50.3 Plus
Dwil\GK23836-PA 283 GK23836-PA 13..128 22..137 316 47.4 Plus
Dwil\GK23821-PA 496 GK23821-PA 30..141 43..153 256 42.9 Plus
Dwil\GK23821-PA 496 GK23821-PA 163..254 43..133 240 47.8 Plus
Dwil\GK25689-PA 196 GK25689-PA 45..188 32..179 194 29.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:36:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\Lectin-galC1-PA 186 GE13247-PA 14..186 14..186 813 84.4 Plus
Dyak\GE13248-PA 186 GE13248-PA 1..186 1..186 577 55.9 Plus
Dyak\GE17444-PA 188 GE17444-PA 37..180 32..179 204 29.4 Plus
Dyak\GE10673-PA 153 GE10673-PA 27..153 43..174 143 32.4 Plus
Dyak\GE14533-PA 282 GE14533-PA 165..278 51..174 140 28.6 Plus

IP02782.hyp Sequence

Translation from 2 to 562

> IP02782.hyp
MLKLTVLLITLLVIAKTGWTREKFSIQVNEGNTFGALVKAEPFTKINDGY
YFFGTESLNWYEAYEKCRELNSELVTFETDQEFDAVTAFLTANGSRLTYW
TSGNDLAKTGSHRWFTNAQRISSLRWARNQPDNAGQKEHCIHLGYIYKDS
RKFELNDRPCSQDPNSLFKYICEAPEMETISIVVWK*

IP02782.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:53:54
Subject Length Description Subject Range Query Range Score Percent Strand
Lectin-galC1-PB 186 CG9976-PB 1..186 1..186 999 100 Plus
Lectin-galC1-PA 186 CG9976-PA 1..186 1..186 999 100 Plus
lectin-37Da-PB 186 CG33532-PB 1..186 1..186 592 57.5 Plus
lectin-37Da-PA 186 CG33532-PA 1..186 1..186 592 57.5 Plus
CG43055-PA 180 CG43055-PA 22..180 23..185 321 39.8 Plus