Clone IP02817 Report

Search the DGRC for IP02817

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:28
Well:17
Vector:pOT2
Associated Gene/TranscriptEh-RA
Protein status:IP02817.pep: gold
Preliminary Size:1374
Sequenced Size:701

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5400 2005-01-01 Successful iPCR screen
Eh 2008-04-29 Release 5.5 accounting
Eh 2008-08-15 Release 5.9 accounting
Eh 2008-12-18 5.12 accounting

Clone Sequence Records

IP02817.complete Sequence

701 bp assembled on 2006-11-09

GenBank Submission: BT023233

> IP02817.complete
ACGTGTTGCCAAGTACTTGGCGAGTTATCCAAAAAGCCCACACCTTTGCT
GCCAAACAATCAACTACCGACAGACAACGGTCGCAAGCTAGTCAGCTCCC
CAAACACATCCGTTGGAATCAAAGTACCAATATCACCATCATGAACTGCA
AGCCCTTGATTTTGTGCACCTTTGTGGCAGTTGCAATGTGCCTGGTGCAT
TTTGGAAATGCATTGCCCGCCATAAGTCATTATACGCACAAGAGATTTGA
CTCCATGGGTGGCATTGATTTTGTTCAGGTGTGCCTTAACAACTGCGTCC
AGTGCAAGACCATGCTGGGAGATTACTTCCAGGGGCAGACCTGTGCCCTT
TCCTGCCTCAAGTTCAAGGGCAAAGCCATCCCGGACTGCGAGGATATAGC
CTCCATAGCCCCGTTTCTGAATGCGCTCGAGTGAAGCGATAAGAGGCGCC
TCTTGTGCGATGTGCGGTGTGTGTGGCGGTGTGTGCTTTTATGGCCTGTG
ACTCAGGTGTGGATTTGGGTCAATGTGATGCTCAACACGATGCTCAAGTC
TTGGCGATCTTGGCTGCTGATATCGACCACAACGATGATGAAATGACTTT
TGCTAAACAACTGACTTTCTAGCGTGAAACCAAAGAGTTCCTATTAACTT
GTAATTGTGTAGTAAATAAACAAATATTAAGAAAAAAAAAAAAAAAAAAA
A

IP02817.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:12:42
Subject Length Description Subject Range Query Range Score Percent Strand
Eh-RA 1400 Eh-RA 694..1379 1..686 3430 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:07:47
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 13271015..13271427 681..269 1975 98.5 Minus
chr3R 27901430 chr3R 13271724..13271904 249..69 905 100 Minus
chr3R 27901430 chr3R 13273141..13273209 69..1 345 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:36:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:07:45
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17446637..17447054 686..269 2060 99.5 Minus
3R 32079331 3R 17447351..17447531 249..69 905 100 Minus
3R 32079331 3R 17448767..17448835 69..1 345 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:06:34
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 17187468..17187885 686..269 2060 99.5 Minus
3R 31820162 3R 17188182..17188362 249..69 905 100 Minus
3R 31820162 3R 17189598..17189666 69..1 345 100 Minus
3R 31820162 3R 17188074..17188106 281..249 165 100 Minus
Blast to na_te.dros performed 2019-03-15 22:07:46
Subject Length Description Subject Range Query Range Score Percent Strand
gypsy5 7369 gypsy5 GYPSY5 7369bp 639..696 681..624 128 69 Minus

IP02817.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:08:34 Download gff for IP02817.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 13271015..13271417 279..681 99 <- Minus
chr3R 13271619..13271647 250..278 100 <- Minus
chr3R 13271724..13271903 70..249 100 <- Minus
chr3R 13273141..13273209 1..69 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:19:01 Download gff for IP02817.complete
Subject Subject Range Query Range Percent Splice Strand
Eh-RA 1..294 141..434 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:20:13 Download gff for IP02817.complete
Subject Subject Range Query Range Percent Splice Strand
Eh-RA 1..294 141..434 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:09:52 Download gff for IP02817.complete
Subject Subject Range Query Range Percent Splice Strand
Eh-RA 1..294 141..434 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:37:07 Download gff for IP02817.complete
Subject Subject Range Query Range Percent Splice Strand
Eh-RA 1..294 141..434 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:13:09 Download gff for IP02817.complete
Subject Subject Range Query Range Percent Splice Strand
Eh-RA 1..294 141..434 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:48:30 Download gff for IP02817.complete
Subject Subject Range Query Range Percent Splice Strand
Eh-RA 694..1374 1..681 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:20:13 Download gff for IP02817.complete
Subject Subject Range Query Range Percent Splice Strand
Eh-RA 694..1374 1..681 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:09:52 Download gff for IP02817.complete
Subject Subject Range Query Range Percent Splice Strand
Eh-RA 24..704 1..681 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:37:07 Download gff for IP02817.complete
Subject Subject Range Query Range Percent Splice Strand
Eh-RA 694..1374 1..681 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:13:09 Download gff for IP02817.complete
Subject Subject Range Query Range Percent Splice Strand
Eh-RA 24..704 1..681 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:08:34 Download gff for IP02817.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17448767..17448835 1..69 100   Minus
3R 17446642..17447044 279..681 100 <- Minus
3R 17447246..17447274 250..278 100 <- Minus
3R 17447351..17447530 70..249 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:08:34 Download gff for IP02817.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17448767..17448835 1..69 100   Minus
3R 17446642..17447044 279..681 100 <- Minus
3R 17447246..17447274 250..278 100 <- Minus
3R 17447351..17447530 70..249 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:08:34 Download gff for IP02817.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17448767..17448835 1..69 100   Minus
3R 17446642..17447044 279..681 100 <- Minus
3R 17447246..17447274 250..278 100 <- Minus
3R 17447351..17447530 70..249 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:09:52 Download gff for IP02817.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13273073..13273252 70..249 100 <- Minus
arm_3R 13272364..13272766 279..681 100 <- Minus
arm_3R 13272968..13272996 250..278 100 <- Minus
arm_3R 13274489..13274557 1..69 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:49:18 Download gff for IP02817.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17187473..17187875 279..681 100 <- Minus
3R 17188077..17188105 250..278 100 <- Minus
3R 17188182..17188361 70..249 100 <- Minus
3R 17189598..17189666 1..69 100   Minus

IP02817.hyp Sequence

Translation from 2 to 433

> IP02817.hyp
VLPSTWRVIQKAHTFAAKQSTTDRQRSQASQLPKHIRWNQSTNITIMNCK
PLILCTFVAVAMCLVHFGNALPAISHYTHKRFDSMGGIDFVQVCLNNCVQ
CKTMLGDYFQGQTCALSCLKFKGKAIPDCEDIASIAPFLNALE*

IP02817.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:54:18
Subject Length Description Subject Range Query Range Score Percent Strand
Eh-PB 97 CG5400-PB 1..97 47..143 530 100 Plus
Eh-PA 97 CG5400-PA 1..97 47..143 530 100 Plus

IP02817.pep Sequence

Translation from 140 to 433

> IP02817.pep
MNCKPLILCTFVAVAMCLVHFGNALPAISHYTHKRFDSMGGIDFVQVCLN
NCVQCKTMLGDYFQGQTCALSCLKFKGKAIPDCEDIASIAPFLNALE*

IP02817.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:40:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18611-PA 97 GF18611-PA 1..97 1..97 476 90.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:40:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16772-PA 97 GG16772-PA 1..97 1..97 504 97.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:40:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17491-PA 97 GH17491-PA 5..97 4..97 367 72.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:56:36
Subject Length Description Subject Range Query Range Score Percent Strand
Eh-PB 97 CG5400-PB 1..97 1..97 530 100 Plus
Eh-PA 97 CG5400-PA 1..97 1..97 530 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:40:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22821-PA 97 GI22821-PA 20..97 19..97 341 79.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:40:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23932-PA 96 GL23932-PA 1..96 1..97 433 84.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:40:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18853-PA 96 GA18853-PA 1..96 1..97 433 84.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:40:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\Eh-PA 97 GM15361-PA 1..97 1..97 509 99 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:40:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Eh-PA 97 GD20231-PA 1..97 1..97 509 99 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:40:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22822-PA 97 GJ22822-PA 3..97 2..97 366 72.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:40:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11451-PA 100 GK11451-PA 5..100 4..97 342 69.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:40:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25269-PA 97 GE25269-PA 1..97 1..97 511 100 Plus