BDGP Sequence Production Resources |
Search the DGRC for IP02903
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 29 |
Well: | 3 |
Vector: | pOT2 |
Associated Gene/Transcript | CG4101-RA |
Protein status: | IP02903.pep: gold |
Preliminary Size: | 264 |
Sequenced Size: | 427 |
Gene | Date | Evidence |
---|---|---|
CG4101 | 2005-01-01 | Successful iPCR screen |
CG4101 | 2008-04-29 | Release 5.5 accounting |
CG4101 | 2008-08-15 | Release 5.9 accounting |
CG4101 | 2008-12-18 | 5.12 accounting |
427 bp (427 high quality bases) assembled on 2005-03-01
GenBank Submission: BT023225
> IP02903.complete CGGGTTTTGTTTATAAACAATACCAGCGCAGCGATGTCGGCTTCCGCGGA CAGTCTGGGCGCCGCCGCAGCCCTGGACAAGTACGGCGACGAGGACATCT TCAGCTTGCTAATCCGATACGGGCTTTATGTGGGTGCTCTCTTCCAGTTC GTTTGCATTTCGGCCGCAGTATTGATGGAGAATAACCCGGATGGCCAAAG TAATCCGGAGTCCGGCGAAGTGACGGAGCGGGAGGGCGAGCCGGTCCGGA CGCGCCTGCACAAGATTCGTAAGCTGGAGAAGAAGAAGCGACGATAGATG TAGCCATCCTTAATATATACATATGTAGCTAGCCTAAGAACTCTCGAATT CATTTATTAAGATAATTGTAATAAAACCTAGTCGACAACGATTAAAGTAG AAGCCTGCAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG4101-RA | 466 | CG4101-RA | 58..466 | 1..409 | 2045 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 16602286..16602693 | 1..408 | 2040 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 16612543..16612951 | 1..409 | 2045 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 16605643..16606051 | 1..409 | 2045 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 16602286..16602693 | 1..408 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4101-RA | 1..264 | 34..297 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4101-RA | 1..264 | 34..297 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4101-RA | 1..264 | 34..297 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4101-RA | 1..264 | 34..297 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4101-RA | 1..264 | 34..297 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4101-RA | 58..465 | 1..408 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4101-RA | 58..465 | 1..408 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4101-RA | 58..465 | 1..408 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4101-RA | 58..465 | 1..408 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG4101-RA | 58..465 | 1..408 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16612543..16612950 | 1..408 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16612543..16612950 | 1..408 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16612543..16612950 | 1..408 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 16605643..16606050 | 1..408 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16605643..16606050 | 1..408 | 100 | Plus |
Translation from 0 to 296
> IP02903.hyp RVLFINNTSAAMSASADSLGAAAALDKYGDEDIFSLLIRYGLYVGALFQF VCISAAVLMENNPDGQSNPESGEVTEREGEPVRTRLHKIRKLEKKKRR*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG4101-PA | 87 | CG4101-PA | 1..87 | 12..98 | 438 | 100 | Plus |
Translation from 33 to 296
> IP02903.pep MSASADSLGAAAALDKYGDEDIFSLLIRYGLYVGALFQFVCISAAVLMEN NPDGQSNPESGEVTEREGEPVRTRLHKIRKLEKKKRR*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23923-PA | 83 | GF23923-PA | 16..83 | 15..87 | 278 | 78.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG13569-PA | 87 | GG13569-PA | 16..87 | 16..87 | 367 | 95.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15017-PA | 87 | GH15017-PA | 2..87 | 4..87 | 255 | 62.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG4101-PA | 87 | CG4101-PA | 1..87 | 1..87 | 438 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI16671-PA | 89 | GI16671-PA | 2..89 | 4..87 | 231 | 57.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL12848-PA | 86 | GL12848-PA | 1..86 | 1..87 | 300 | 68.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA17958-PA | 86 | GA17958-PA | 1..86 | 1..87 | 300 | 68.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25648-PA | 87 | GM25648-PA | 16..87 | 16..87 | 374 | 95.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14652-PA | 87 | GD14652-PA | 16..87 | 16..87 | 375 | 97.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12923-PA | 89 | GJ12923-PA | 2..89 | 4..87 | 237 | 60.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK18891-PA | 99 | GK18891-PA | 3..99 | 2..87 | 268 | 63.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE19866-PA | 87 | GE19866-PA | 16..87 | 16..87 | 375 | 97.2 | Plus |