Clone IP02903 Report

Search the DGRC for IP02903

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:29
Well:3
Vector:pOT2
Associated Gene/TranscriptCG4101-RA
Protein status:IP02903.pep: gold
Preliminary Size:264
Sequenced Size:427

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4101 2005-01-01 Successful iPCR screen
CG4101 2008-04-29 Release 5.5 accounting
CG4101 2008-08-15 Release 5.9 accounting
CG4101 2008-12-18 5.12 accounting

Clone Sequence Records

IP02903.complete Sequence

427 bp (427 high quality bases) assembled on 2005-03-01

GenBank Submission: BT023225

> IP02903.complete
CGGGTTTTGTTTATAAACAATACCAGCGCAGCGATGTCGGCTTCCGCGGA
CAGTCTGGGCGCCGCCGCAGCCCTGGACAAGTACGGCGACGAGGACATCT
TCAGCTTGCTAATCCGATACGGGCTTTATGTGGGTGCTCTCTTCCAGTTC
GTTTGCATTTCGGCCGCAGTATTGATGGAGAATAACCCGGATGGCCAAAG
TAATCCGGAGTCCGGCGAAGTGACGGAGCGGGAGGGCGAGCCGGTCCGGA
CGCGCCTGCACAAGATTCGTAAGCTGGAGAAGAAGAAGCGACGATAGATG
TAGCCATCCTTAATATATACATATGTAGCTAGCCTAAGAACTCTCGAATT
CATTTATTAAGATAATTGTAATAAAACCTAGTCGACAACGATTAAAGTAG
AAGCCTGCAAAAAAAAAAAAAAAAAAA

IP02903.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:04:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG4101-RA 466 CG4101-RA 58..466 1..409 2045 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:52:06
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16602286..16602693 1..408 2040 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:36:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:52:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16612543..16612951 1..409 2045 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:59:20
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16605643..16606051 1..409 2045 100 Plus
Blast to na_te.dros performed on 2019-03-16 12:52:05 has no hits.

IP02903.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:53:24 Download gff for IP02903.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16602286..16602693 1..408 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:19:14 Download gff for IP02903.complete
Subject Subject Range Query Range Percent Splice Strand
CG4101-RA 1..264 34..297 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:03:35 Download gff for IP02903.complete
Subject Subject Range Query Range Percent Splice Strand
CG4101-RA 1..264 34..297 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:11:45 Download gff for IP02903.complete
Subject Subject Range Query Range Percent Splice Strand
CG4101-RA 1..264 34..297 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:04:11 Download gff for IP02903.complete
Subject Subject Range Query Range Percent Splice Strand
CG4101-RA 1..264 34..297 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:10:13 Download gff for IP02903.complete
Subject Subject Range Query Range Percent Splice Strand
CG4101-RA 1..264 34..297 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:29:17 Download gff for IP02903.complete
Subject Subject Range Query Range Percent Splice Strand
CG4101-RA 58..465 1..408 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:03:35 Download gff for IP02903.complete
Subject Subject Range Query Range Percent Splice Strand
CG4101-RA 58..465 1..408 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:11:45 Download gff for IP02903.complete
Subject Subject Range Query Range Percent Splice Strand
CG4101-RA 58..465 1..408 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:04:12 Download gff for IP02903.complete
Subject Subject Range Query Range Percent Splice Strand
CG4101-RA 58..465 1..408 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:10:13 Download gff for IP02903.complete
Subject Subject Range Query Range Percent Splice Strand
CG4101-RA 58..465 1..408 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:53:24 Download gff for IP02903.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16612543..16612950 1..408 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:53:24 Download gff for IP02903.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16612543..16612950 1..408 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:53:24 Download gff for IP02903.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16612543..16612950 1..408 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:11:45 Download gff for IP02903.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16605643..16606050 1..408 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:37:51 Download gff for IP02903.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16605643..16606050 1..408 100   Plus

IP02903.hyp Sequence

Translation from 0 to 296

> IP02903.hyp
RVLFINNTSAAMSASADSLGAAAALDKYGDEDIFSLLIRYGLYVGALFQF
VCISAAVLMENNPDGQSNPESGEVTEREGEPVRTRLHKIRKLEKKKRR*

IP02903.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:55:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG4101-PA 87 CG4101-PA 1..87 12..98 438 100 Plus

IP02903.pep Sequence

Translation from 33 to 296

> IP02903.pep
MSASADSLGAAAALDKYGDEDIFSLLIRYGLYVGALFQFVCISAAVLMEN
NPDGQSNPESGEVTEREGEPVRTRLHKIRKLEKKKRR*

IP02903.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 18:54:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23923-PA 83 GF23923-PA 16..83 15..87 278 78.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 18:54:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13569-PA 87 GG13569-PA 16..87 16..87 367 95.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 18:54:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15017-PA 87 GH15017-PA 2..87 4..87 255 62.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG4101-PA 87 CG4101-PA 1..87 1..87 438 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 18:54:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16671-PA 89 GI16671-PA 2..89 4..87 231 57.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 18:54:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12848-PA 86 GL12848-PA 1..86 1..87 300 68.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 18:54:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17958-PA 86 GA17958-PA 1..86 1..87 300 68.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 18:54:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25648-PA 87 GM25648-PA 16..87 16..87 374 95.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 18:54:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14652-PA 87 GD14652-PA 16..87 16..87 375 97.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 18:54:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12923-PA 89 GJ12923-PA 2..89 4..87 237 60.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 18:54:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18891-PA 99 GK18891-PA 3..99 2..87 268 63.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 18:54:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19866-PA 87 GE19866-PA 16..87 16..87 375 97.2 Plus