Clone IP02950 Report

Search the DGRC for IP02950

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:29
Well:50
Vector:pOT2
Associated Gene/TranscriptCG8498-RA
Protein status:IP02950.pep: gold
Preliminary Size:273
Sequenced Size:479

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8498 2005-01-01 Successful iPCR screen
CG8498 2008-04-29 Release 5.5 accounting
CG8498 2008-08-15 Release 5.9 accounting
CG8498 2008-12-18 5.12 accounting

Clone Sequence Records

IP02950.complete Sequence

479 bp (479 high quality bases) assembled on 2004-12-17

GenBank Submission: BT023703

> IP02950.complete
GGTGAAGTAAAATCGTGCAATTTCTTTTCCAAAGACTTCCACTAGTTAAA
AAATAGATACAAAAATGTCCGAATTGCAGGAATTCAACCAGGCGGCCGAA
GATGTTAAGAACCTAAACACCACACCCGGGGACAATGACCTTTTGGAGCT
CTACAGCTTGTACAAACAGGCCACTGTGGGGGATTGCAATACAGATAAGC
CCGGCTTTCTGGACTTCAAGGGCAAGGCCAAGTGGGAGGCGTGGAACAAC
CGCAAGGGAATGAGCAATACCGACGCCCAGGCCGCCTACATTACCAAGGT
CAAGGCACTGATCGCTGCCGTTGGCCTGAAGTCATAGACTCAATCGAAAT
AGGATGTTGCATTTTATAGTCTCAGTTGTCGTCAAACGCACAAACTTTGA
TTTACAGAAACTTCGCACAAACTAAAATTTTTCGCACAATATACACCACA
AATTCGTAACGTAAAAAAAAAAAAAAAAA

IP02950.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:44:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG8498-RA 629 CG8498-RA 96..559 1..464 2320 100 Plus
Rbsn-5-RA 1896 Rbsn-5-RA 1834..1896 464..402 315 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:34:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8160816..8161091 462..187 1365 99.6 Minus
chr2L 23010047 chr2L 8161143..8161260 194..77 590 100 Minus
chr2L 23010047 chr2L 8161330..8161409 80..1 400 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:36:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:34:26
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8161794..8162071 464..187 1375 99.6 Minus
2L 23513712 2L 8162123..8162240 194..77 590 100 Minus
2L 23513712 2L 8162310..8162389 80..1 400 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:05:06
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8161794..8162071 464..187 1375 99.6 Minus
2L 23513712 2L 8162123..8162240 194..77 590 100 Minus
2L 23513712 2L 8162310..8162389 80..1 400 100 Minus
Blast to na_te.dros performed on 2019-03-15 17:34:26 has no hits.

IP02950.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:35:26 Download gff for IP02950.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8160816..8161083 195..462 100 <- Minus
chr2L 8161143..8161257 80..194 100 <- Minus
chr2L 8161331..8161409 1..79 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:19:24 Download gff for IP02950.complete
Subject Subject Range Query Range Percent Splice Strand
CG8498-RA 1..273 65..337 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:38:12 Download gff for IP02950.complete
Subject Subject Range Query Range Percent Splice Strand
CG8498-RA 1..273 65..337 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:39:55 Download gff for IP02950.complete
Subject Subject Range Query Range Percent Splice Strand
CG8498-RA 1..273 65..337 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:14:44 Download gff for IP02950.complete
Subject Subject Range Query Range Percent Splice Strand
CG8498-RA 1..273 65..337 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:41:01 Download gff for IP02950.complete
Subject Subject Range Query Range Percent Splice Strand
CG8498-RA 1..273 65..337 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:42:33 Download gff for IP02950.complete
Subject Subject Range Query Range Percent Splice Strand
CG8498-RA 1..462 1..462 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:38:12 Download gff for IP02950.complete
Subject Subject Range Query Range Percent Splice Strand
CG8498-RA 1..462 1..462 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:39:55 Download gff for IP02950.complete
Subject Subject Range Query Range Percent Splice Strand
CG8498-RA 30..491 1..462 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:14:44 Download gff for IP02950.complete
Subject Subject Range Query Range Percent Splice Strand
CG8498-RA 1..462 1..462 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:41:01 Download gff for IP02950.complete
Subject Subject Range Query Range Percent Splice Strand
CG8498-RA 30..491 1..462 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:35:26 Download gff for IP02950.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8162311..8162389 1..79 100   Minus
2L 8161796..8162063 195..462 100 <- Minus
2L 8162123..8162237 80..194 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:35:26 Download gff for IP02950.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8162311..8162389 1..79 100   Minus
2L 8161796..8162063 195..462 100 <- Minus
2L 8162123..8162237 80..194 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:35:26 Download gff for IP02950.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8162311..8162389 1..79 100   Minus
2L 8161796..8162063 195..462 100 <- Minus
2L 8162123..8162237 80..194 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:39:55 Download gff for IP02950.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8162123..8162237 80..194 100 <- Minus
arm_2L 8162311..8162389 1..79 100   Minus
arm_2L 8161796..8162063 195..462 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:50:54 Download gff for IP02950.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8161796..8162063 195..462 100 <- Minus
2L 8162123..8162237 80..194 100 <- Minus
2L 8162311..8162389 1..79 100   Minus

IP02950.hyp Sequence

Translation from 64 to 336

> IP02950.hyp
MSELQEFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLD
FKGKAKWEAWNNRKGMSNTDAQAAYITKVKALIAAVGLKS*

IP02950.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:55:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG8498-PB 90 CG8498-PB 1..90 1..90 470 100 Plus
CG8498-PA 90 CG8498-PA 1..90 1..90 470 100 Plus
Dbi-PA 86 CG8627-PA 4..83 5..84 251 58.8 Plus
Dbi-PB 86 CG8627-PB 4..83 5..84 251 58.8 Plus
CG8629-PA 84 CG8629-PA 4..73 7..76 206 55.7 Plus

IP02950.pep Sequence

Translation from 64 to 336

> IP02950.pep
MSELQEFNQAAEDVKNLNTTPGDNDLLELYSLYKQATVGDCNTDKPGFLD
FKGKAKWEAWNNRKGMSNTDAQAAYITKVKALIAAVGLKS*

IP02950.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 21:54:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14408-PA 88 GF14408-PA 3..88 5..90 409 87.2 Plus
Dana\GF25011-PA 85 GF25011-PA 1..82 1..84 250 59.5 Plus
Dana\GF24791-PA 84 GF24791-PA 4..73 7..76 204 52.9 Plus
Dana\GF25010-PA 84 GF25010-PA 4..73 7..76 194 51.4 Plus
Dana\GF25009-PA 82 GF25009-PA 4..71 7..76 152 41.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 21:54:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23473-PA 90 GG23473-PA 1..90 1..90 460 97.8 Plus
Dere\GG14406-PA 86 GG14406-PA 4..83 5..84 249 57.5 Plus
Dere\GG14997-PA 84 GG14997-PA 4..73 7..76 212 55.7 Plus
Dere\GG14405-PA 84 GG14405-PA 4..73 7..76 192 51.4 Plus
Dere\GG17546-PA 243 GG17546-PA 13..88 7..82 179 44.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 21:54:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11506-PA 90 GH11506-PA 1..90 1..90 404 84.4 Plus
Dgri\GH14518-PA 87 GH14518-PA 1..84 1..84 251 56 Plus
Dgri\GH16140-PA 84 GH16140-PA 1..73 4..76 224 57.5 Plus
Dgri\GH17042-PA 84 GH17042-PA 4..73 7..76 206 54.3 Plus
Dgri\GH12890-PA 264 GH12890-PA 43..101 24..82 177 55.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:22:51
Subject Length Description Subject Range Query Range Score Percent Strand
Acbp1-PB 90 CG8498-PB 1..90 1..90 470 100 Plus
Acbp1-PA 90 CG8498-PA 1..90 1..90 470 100 Plus
Acbp2-PA 86 CG8627-PA 4..83 5..84 251 58.8 Plus
Acbp2-PB 86 CG8627-PB 4..83 5..84 251 58.8 Plus
Acbp4-PA 84 CG8629-PA 4..73 7..76 206 55.7 Plus
Acbp3-PA 84 CG8628-PA 4..73 7..76 178 48.6 Plus
Acbp3-PB 84 CG8628-PB 4..73 7..76 178 48.6 Plus
anox-PB 243 CG33713-PB 13..88 7..82 162 42.1 Plus
anox-PA 243 CG33713-PA 13..88 7..82 162 42.1 Plus
Acbp6-PB 82 CG15829-PB 4..75 7..80 158 41.9 Plus
Acbp6-PA 82 CG15829-PA 4..75 7..80 158 41.9 Plus
CG8814-PA 324 CG8814-PA 1..89 1..83 151 38.2 Plus
Acbp5-PA 82 CG5804-PA 1..71 4..76 150 43.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 21:54:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17002-PA 90 GI17002-PA 1..90 1..90 388 80 Plus
Dmoj\GI13295-PA 87 GI13295-PA 1..84 1..84 254 58.3 Plus
Dmoj\GI14444-PA 264 GI14444-PA 24..99 7..82 176 44.7 Plus
Dmoj\GI11160-PA 322 GI11160-PA 1..88 1..83 154 36.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 21:54:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19321-PA 90 GL19321-PA 1..90 1..90 422 87.8 Plus
Dper\GL25029-PA 87 GL25029-PA 1..84 1..84 269 60.7 Plus
Dper\GL25142-PA 84 GL25142-PA 4..73 7..76 213 54.3 Plus
Dper\GL25027-PA 84 GL25027-PA 4..73 7..76 198 51.4 Plus
Dper\GL25026-PA 82 GL25026-PA 4..79 7..84 158 42.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 21:54:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21120-PA 90 GA21120-PA 1..90 1..90 427 88.9 Plus
Dpse\GA21218-PA 87 GA21218-PA 1..84 1..84 268 60.7 Plus
Dpse\GA21220-PA 84 GA21220-PA 4..73 7..76 213 54.3 Plus
Dpse\GA23591-PA 84 GA23591-PA 4..73 7..76 198 51.4 Plus
Dpse\GA13977-PA 82 GA13977-PA 4..79 7..84 158 42.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 21:54:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13159-PA 90 GM13159-PA 1..90 1..90 466 98.9 Plus
Dsec\GM14822-PA 86 GM14822-PA 4..83 5..84 254 60 Plus
Dsec\GM13788-PA 84 GM13788-PA 4..73 7..76 211 55.7 Plus
Dsec\GM14821-PA 84 GM14821-PA 4..73 7..76 187 50 Plus
Dsec\GM22630-PA 243 GM22630-PA 8..88 2..82 175 43.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 21:54:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22437-PA 90 GD22437-PA 1..90 1..90 466 98.9 Plus
Dsim\GD13995-PA 86 GD13995-PA 4..83 5..84 255 60 Plus
Dsim\GD13089-PA 84 GD13089-PA 4..73 7..76 211 55.7 Plus
Dsim\GD13994-PA 84 GD13994-PA 4..73 7..76 187 50 Plus
Dsim\GD15501-PA 243 GD15501-PA 8..88 2..82 175 43.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 21:54:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24270-PA 90 GJ24270-PA 1..90 1..90 397 82.2 Plus
Dvir\GJ12061-PA 87 GJ12061-PA 1..84 1..84 252 58.3 Plus
Dvir\GJ12299-PA 83 GJ12299-PA 2..72 6..76 215 57.7 Plus
Dvir\GJ13316-PA 84 GJ13316-PA 4..73 7..76 215 58.6 Plus
Dvir\GJ18782-PA 259 GJ18782-PA 38..96 24..82 166 52.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 21:54:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23743-PA 90 GK23743-PA 1..90 1..90 441 93.3 Plus
Dwil\GK16653-PA 87 GK16653-PA 1..84 1..84 257 58.3 Plus
Dwil\GK19286-PA 81 GK19286-PA 1..70 7..76 215 58.6 Plus
Dwil\GK17538-PA 84 GK17538-PA 4..73 7..76 210 54.3 Plus
Dwil\GK16652-PA 82 GK16652-PA 4..79 7..84 171 42.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 21:54:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11169-PA 90 GE11169-PA 1..90 1..90 461 97.8 Plus
Dyak\GE21596-PA 86 GE21596-PA 4..83 5..84 251 58.8 Plus
Dyak\GE20443-PA 84 GE20443-PA 4..73 7..76 207 54.3 Plus
Dyak\GE21595-PA 84 GE21595-PA 4..73 7..76 188 50 Plus
Dyak\GE15306-PA 243 GE15306-PA 13..88 7..82 167 44.7 Plus