BDGP Sequence Production Resources |
Search the DGRC for IP03042
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 30 |
Well: | 42 |
Vector: | pOT2 |
Associated Gene/Transcript | CG7637-RA |
Protein status: | IP03042.pep: gold |
Preliminary Size: | 274 |
Sequenced Size: | 317 |
Gene | Date | Evidence |
---|---|---|
CG7637 | 2005-01-01 | Successful iPCR screen |
CG7637 | 2008-04-29 | Release 5.5 accounting |
CG7637 | 2008-08-15 | Release 5.9 accounting |
CG7637 | 2008-12-18 | 5.12 accounting |
317 bp (317 high quality bases) assembled on 2004-12-17
GenBank Submission: BT023704
> IP03042.complete TCTGCTTCTTTGACTACAGAAAAACAATCCAAAAACTGCAAAAATGTATC TGATGTACACAATTAACGAAAACGGCGATCGCGTTTACACCCTGAAGAAA CGCACCGAGGATGGTCGTCCCACACTATCTGCTCATCCAGCACGTTTTTC ACCGGAGGATAAGTACTCCCGCCAGAGGCTGACCATCAAGAAGCGCTTTG GACTGCTGCTCACCCAGAAGCCGGAGCCCATTTACTAAGCCGCATTTTAG TTTTAATTAGTGTACATCTTTATTTACAAATAATAAGCTACAAAACAACA AAAAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 6698361..6698456 | 1..97 | 98 | Minus | |
chr2R | 6698094..6698295 | 98..299 | 99 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7637-RA | 1..195 | 44..238 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7637-RA | 1..195 | 44..238 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7637-RA | 1..195 | 44..238 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7637-RA | 1..195 | 44..238 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7637-RA | 1..195 | 44..238 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7637-RA | 1..270 | 30..299 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7637-RA | 1..270 | 30..299 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7637-RA | 18..316 | 1..299 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7637-RA | 1..270 | 30..299 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7637-RA | 18..316 | 1..299 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 10810556..10810757 | 98..299 | 100 | <- | Minus |
2R | 10810823..10810919 | 1..97 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 10810556..10810757 | 98..299 | 100 | <- | Minus |
2R | 10810823..10810919 | 1..97 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 10810556..10810757 | 98..299 | 100 | <- | Minus |
2R | 10810823..10810919 | 1..97 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 6698061..6698262 | 98..299 | 100 | <- | Minus |
arm_2R | 6698328..6698424 | 1..97 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 10811755..10811956 | 98..299 | 100 | <- | Minus |
2R | 10812022..10812118 | 1..97 | 100 | Minus |
Translation from 43 to 237
> IP03042.pep MYLMYTINENGDRVYTLKKRTEDGRPTLSAHPARFSPEDKYSRQRLTIKK RFGLLLTQKPEPIY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11086-PA | 64 | GF11086-PA | 1..64 | 1..64 | 327 | 96.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22719-PA | 64 | GG22719-PA | 1..64 | 1..64 | 333 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20611-PA | 64 | GH20611-PA | 1..64 | 1..64 | 322 | 95.3 | Plus |
Dgri\GH22437-PA | 64 | GH22437-PA | 1..64 | 1..64 | 322 | 95.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG7637-PA | 64 | CG7637-PA | 1..64 | 1..64 | 337 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI19167-PA | 64 | GI19167-PA | 1..64 | 1..64 | 320 | 93.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17179-PA | 64 | GL17179-PA | 1..64 | 1..64 | 316 | 92.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20497-PA | 64 | GA20497-PA | 1..64 | 1..64 | 316 | 92.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM20494-PA | 64 | GM20494-PA | 1..64 | 1..64 | 333 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD25957-PA | 64 | GD25957-PA | 1..64 | 1..64 | 333 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20125-PA | 64 | GJ20125-PA | 1..64 | 1..64 | 333 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19481-PA | 64 | GK19481-PA | 1..64 | 1..64 | 332 | 98.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13075-PA | 64 | GE13075-PA | 1..64 | 1..64 | 333 | 100 | Plus |
Translation from 43 to 237
> IP03042.hyp MYLMYTINENGDRVYTLKKRTEDGRPTLSAHPARFSPEDKYSRQRLTIKK RFGLLLTQKPEPIY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG7637-PA | 64 | CG7637-PA | 1..64 | 1..64 | 337 | 100 | Plus |