Clone IP03042 Report

Search the DGRC for IP03042

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:30
Well:42
Vector:pOT2
Associated Gene/TranscriptCG7637-RA
Protein status:IP03042.pep: gold
Preliminary Size:274
Sequenced Size:317

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7637 2005-01-01 Successful iPCR screen
CG7637 2008-04-29 Release 5.5 accounting
CG7637 2008-08-15 Release 5.9 accounting
CG7637 2008-12-18 5.12 accounting

Clone Sequence Records

IP03042.complete Sequence

317 bp (317 high quality bases) assembled on 2004-12-17

GenBank Submission: BT023704

> IP03042.complete
TCTGCTTCTTTGACTACAGAAAAACAATCCAAAAACTGCAAAAATGTATC
TGATGTACACAATTAACGAAAACGGCGATCGCGTTTACACCCTGAAGAAA
CGCACCGAGGATGGTCGTCCCACACTATCTGCTCATCCAGCACGTTTTTC
ACCGGAGGATAAGTACTCCCGCCAGAGGCTGACCATCAAGAAGCGCTTTG
GACTGCTGCTCACCCAGAAGCCGGAGCCCATTTACTAAGCCGCATTTTAG
TTTTAATTAGTGTACATCTTTATTTACAAATAATAAGCTACAAAACAACA
AAAAAAAAAAAAAAAAA

IP03042.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:50:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG7637-RA 528 CG7637-RA 97..399 1..303 1515 100 Plus
CG12935-RA 1213 CG12935-RA 1102..1213 303..192 560 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:23:32
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 6698094..6698297 299..96 1005 99.5 Minus
chr2R 21145070 chr2R 6698361..6698455 97..3 475 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:36:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:23:30
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10810552..10810759 303..96 1040 100 Minus
2R 25286936 2R 10810823..10810919 97..1 485 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:39:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10811751..10811958 303..96 1040 100 Minus
2R 25260384 2R 10812022..10812118 97..1 485 100 Minus
Blast to na_te.dros performed on 2019-03-15 12:23:31 has no hits.

IP03042.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:24:15 Download gff for IP03042.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 6698361..6698456 1..97 98   Minus
chr2R 6698094..6698295 98..299 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:19:32 Download gff for IP03042.complete
Subject Subject Range Query Range Percent Splice Strand
CG7637-RA 1..195 44..238 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:21:35 Download gff for IP03042.complete
Subject Subject Range Query Range Percent Splice Strand
CG7637-RA 1..195 44..238 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:42:04 Download gff for IP03042.complete
Subject Subject Range Query Range Percent Splice Strand
CG7637-RA 1..195 44..238 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:05:34 Download gff for IP03042.complete
Subject Subject Range Query Range Percent Splice Strand
CG7637-RA 1..195 44..238 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 19:58:03 Download gff for IP03042.complete
Subject Subject Range Query Range Percent Splice Strand
CG7637-RA 1..195 44..238 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:22:30 Download gff for IP03042.complete
Subject Subject Range Query Range Percent Splice Strand
CG7637-RA 1..270 30..299 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:21:35 Download gff for IP03042.complete
Subject Subject Range Query Range Percent Splice Strand
CG7637-RA 1..270 30..299 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:42:04 Download gff for IP03042.complete
Subject Subject Range Query Range Percent Splice Strand
CG7637-RA 18..316 1..299 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:05:34 Download gff for IP03042.complete
Subject Subject Range Query Range Percent Splice Strand
CG7637-RA 1..270 30..299 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 19:58:03 Download gff for IP03042.complete
Subject Subject Range Query Range Percent Splice Strand
CG7637-RA 18..316 1..299 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:24:15 Download gff for IP03042.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10810556..10810757 98..299 100 <- Minus
2R 10810823..10810919 1..97 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:24:15 Download gff for IP03042.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10810556..10810757 98..299 100 <- Minus
2R 10810823..10810919 1..97 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:24:15 Download gff for IP03042.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10810556..10810757 98..299 100 <- Minus
2R 10810823..10810919 1..97 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:42:04 Download gff for IP03042.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6698061..6698262 98..299 100 <- Minus
arm_2R 6698328..6698424 1..97 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:41:54 Download gff for IP03042.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10811755..10811956 98..299 100 <- Minus
2R 10812022..10812118 1..97 100   Minus

IP03042.pep Sequence

Translation from 43 to 237

> IP03042.pep
MYLMYTINENGDRVYTLKKRTEDGRPTLSAHPARFSPEDKYSRQRLTIKK
RFGLLLTQKPEPIY*

IP03042.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:48:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11086-PA 64 GF11086-PA 1..64 1..64 327 96.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:48:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22719-PA 64 GG22719-PA 1..64 1..64 333 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:48:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20611-PA 64 GH20611-PA 1..64 1..64 322 95.3 Plus
Dgri\GH22437-PA 64 GH22437-PA 1..64 1..64 322 95.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:27:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG7637-PA 64 CG7637-PA 1..64 1..64 337 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:48:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19167-PA 64 GI19167-PA 1..64 1..64 320 93.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:48:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17179-PA 64 GL17179-PA 1..64 1..64 316 92.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:48:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20497-PA 64 GA20497-PA 1..64 1..64 316 92.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:48:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20494-PA 64 GM20494-PA 1..64 1..64 333 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:48:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25957-PA 64 GD25957-PA 1..64 1..64 333 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:48:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20125-PA 64 GJ20125-PA 1..64 1..64 333 100 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:48:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19481-PA 64 GK19481-PA 1..64 1..64 332 98.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:48:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13075-PA 64 GE13075-PA 1..64 1..64 333 100 Plus

IP03042.hyp Sequence

Translation from 43 to 237

> IP03042.hyp
MYLMYTINENGDRVYTLKKRTEDGRPTLSAHPARFSPEDKYSRQRLTIKK
RFGLLLTQKPEPIY*

IP03042.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:56:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG7637-PA 64 CG7637-PA 1..64 1..64 337 100 Plus