Clone IP03233 Report

Search the DGRC for IP03233

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:32
Well:33
Vector:pOT2
Associated Gene/TranscriptCG12589-RA
Protein status:IP03233.pep: gold
Preliminary Size:291
Sequenced Size:533

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12589 2005-01-01 Successful iPCR screen
CG12589 2008-04-29 Release 5.5 accounting
CG12589 2008-08-15 Release 5.9 accounting
CG12589 2008-12-18 5.12 accounting

Clone Sequence Records

IP03233.complete Sequence

533 bp assembled on 2006-11-09

GenBank Submission: BT023188

> IP03233.complete
ATTTTTCAAAAATATTTTGTTCAATTGACATATGTATGTATATTCATTAC
CAATATAACAATTTACCATTGCTGTGTAGCACACATCAGTTGCACAATGG
ACGCGCATTCCACAGCCGTCGCAGGCATAGATATGGAACTGGACTTCGGC
GAGGACATGGATGAGCACGGAGAATTGGAGAAAGTGGGTCAGCCTGAGAA
TTTGGTAGCGATGGTGCTGCGCCTGCAGGCGAACCACGTGTGGATCCGGG
AGCAGCTGACTCACCTACAGCGCCGCCTGGTGACCCTTCGGCTGGACAAG
CAAAGAAGCTTATACGAGGGAAAGGAGCGGTTACAGCGACTCCTGCTGAG
CTTGCAGGTGAAACACGGACGCCACTGGGCACTGTAGGGGAATCGATGGA
CGATGGAGCTCGGAATTCAGGTGACGAAAGTGTAAAAGTACAAGCGAACT
ATCTTGGTGAAAGATGATGTAATGATGTTCTCAACTTCGTATTAAATATA
GTGGTTTTAGAAAGCTTAAAAAAAAAAAAAAAA

IP03233.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:04:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG12589-RA 517 CG12589-RA 1..517 1..517 2585 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:36:38
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 962727..963243 517..1 2585 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:37:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:36:36
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5137055..5137573 519..1 2595 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:59:18
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 4877886..4878404 519..1 2595 100 Minus
Blast to na_te.dros performed on 2019-03-16 21:36:36 has no hits.

IP03233.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:38:04 Download gff for IP03233.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 962727..963243 1..517 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:19:50 Download gff for IP03233.complete
Subject Subject Range Query Range Percent Splice Strand
CG12589-RA 1..291 97..387 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:03:32 Download gff for IP03233.complete
Subject Subject Range Query Range Percent Splice Strand
CG12589-RA 1..291 97..387 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:02:42 Download gff for IP03233.complete
Subject Subject Range Query Range Percent Splice Strand
CG12589-RA 1..291 97..387 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:04:07 Download gff for IP03233.complete
Subject Subject Range Query Range Percent Splice Strand
CG12589-RA 1..291 97..387 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:25:20 Download gff for IP03233.complete
Subject Subject Range Query Range Percent Splice Strand
CG12589-RA 1..291 97..387 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:29:12 Download gff for IP03233.complete
Subject Subject Range Query Range Percent Splice Strand
CG12589-RA 1..291 97..387 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:03:31 Download gff for IP03233.complete
Subject Subject Range Query Range Percent Splice Strand
CG12589-RA 1..517 1..517 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:02:42 Download gff for IP03233.complete
Subject Subject Range Query Range Percent Splice Strand
CG12589-RA 1..517 1..517 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:04:07 Download gff for IP03233.complete
Subject Subject Range Query Range Percent Splice Strand
CG12589-RA 1..291 97..387 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:25:20 Download gff for IP03233.complete
Subject Subject Range Query Range Percent Splice Strand
CG12589-RA 1..517 1..517 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:38:04 Download gff for IP03233.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5137057..5137573 1..517 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:38:04 Download gff for IP03233.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5137057..5137573 1..517 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:38:04 Download gff for IP03233.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5137057..5137573 1..517 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:02:42 Download gff for IP03233.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 962779..963295 1..517 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:37:49 Download gff for IP03233.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4877888..4878404 1..517 100   Minus

IP03233.hyp Sequence

Translation from 0 to 386

> IP03233.hyp
IFQKYFVQLTYVCIFITNITIYHCCVAHISCTMDAHSTAVAGIDMELDFG
EDMDEHGELEKVGQPENLVAMVLRLQANHVWIREQLTHLQRRLVTLRLDK
QRSLYEGKERLQRLLLSLQVKHGRHWAL*

IP03233.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:58:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG12589-PC 96 CG12589-PC 1..96 33..128 494 100 Plus
CG12589-PB 96 CG12589-PB 1..96 33..128 494 100 Plus
CG12589-PA 96 CG12589-PA 1..96 33..128 494 100 Plus

IP03233.pep Sequence

Translation from 96 to 386

> IP03233.pep
MDAHSTAVAGIDMELDFGEDMDEHGELEKVGQPENLVAMVLRLQANHVWI
REQLTHLQRRLVTLRLDKQRSLYEGKERLQRLLLSLQVKHGRHWAL*

IP03233.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:02:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16073-PA 91 GF16073-PA 1..91 1..96 206 53.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:02:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11200-PA 96 GG11200-PA 1..96 1..96 377 89.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG12589-PC 96 CG12589-PC 1..96 1..96 494 100 Plus
CG12589-PB 96 CG12589-PB 1..96 1..96 494 100 Plus
CG12589-PA 96 CG12589-PA 1..96 1..96 494 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:02:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10660-PA 96 GM10660-PA 1..96 1..96 431 88.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:02:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11022-PA 77 GJ11022-PA 1..77 21..96 162 50.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:02:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14291-PA 95 GK14291-PA 1..95 1..96 170 43.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:02:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25310-PA 96 GE25310-PA 1..96 1..96 366 87.5 Plus