IP03233.complete Sequence
533 bp assembled on 2006-11-09
GenBank Submission: BT023188
> IP03233.complete
ATTTTTCAAAAATATTTTGTTCAATTGACATATGTATGTATATTCATTAC
CAATATAACAATTTACCATTGCTGTGTAGCACACATCAGTTGCACAATGG
ACGCGCATTCCACAGCCGTCGCAGGCATAGATATGGAACTGGACTTCGGC
GAGGACATGGATGAGCACGGAGAATTGGAGAAAGTGGGTCAGCCTGAGAA
TTTGGTAGCGATGGTGCTGCGCCTGCAGGCGAACCACGTGTGGATCCGGG
AGCAGCTGACTCACCTACAGCGCCGCCTGGTGACCCTTCGGCTGGACAAG
CAAAGAAGCTTATACGAGGGAAAGGAGCGGTTACAGCGACTCCTGCTGAG
CTTGCAGGTGAAACACGGACGCCACTGGGCACTGTAGGGGAATCGATGGA
CGATGGAGCTCGGAATTCAGGTGACGAAAGTGTAAAAGTACAAGCGAACT
ATCTTGGTGAAAGATGATGTAATGATGTTCTCAACTTCGTATTAAATATA
GTGGTTTTAGAAAGCTTAAAAAAAAAAAAAAAA
IP03233.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:04:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12589-RA | 517 | CG12589-RA | 1..517 | 1..517 | 2585 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 21:36:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 962727..963243 | 517..1 | 2585 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:37:09 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 21:36:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 5137055..5137573 | 519..1 | 2595 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:59:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 4877886..4878404 | 519..1 | 2595 | 100 | Minus |
Blast to na_te.dros performed on 2019-03-16 21:36:36 has no hits.
IP03233.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 21:38:04 Download gff for
IP03233.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 962727..963243 | 1..517 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:19:50 Download gff for
IP03233.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12589-RA | 1..291 | 97..387 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:03:32 Download gff for
IP03233.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12589-RA | 1..291 | 97..387 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:02:42 Download gff for
IP03233.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12589-RA | 1..291 | 97..387 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:04:07 Download gff for
IP03233.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12589-RA | 1..291 | 97..387 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:25:20 Download gff for
IP03233.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12589-RA | 1..291 | 97..387 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:29:12 Download gff for
IP03233.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12589-RA | 1..291 | 97..387 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:03:31 Download gff for
IP03233.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12589-RA | 1..517 | 1..517 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:02:42 Download gff for
IP03233.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12589-RA | 1..517 | 1..517 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:04:07 Download gff for
IP03233.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12589-RA | 1..291 | 97..387 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:25:20 Download gff for
IP03233.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG12589-RA | 1..517 | 1..517 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:38:04 Download gff for
IP03233.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 5137057..5137573 | 1..517 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:38:04 Download gff for
IP03233.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 5137057..5137573 | 1..517 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 21:38:04 Download gff for
IP03233.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 5137057..5137573 | 1..517 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:02:42 Download gff for
IP03233.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 962779..963295 | 1..517 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:37:49 Download gff for
IP03233.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 4877888..4878404 | 1..517 | 100 | | Minus |
IP03233.hyp Sequence
Translation from 0 to 386
> IP03233.hyp
IFQKYFVQLTYVCIFITNITIYHCCVAHISCTMDAHSTAVAGIDMELDFG
EDMDEHGELEKVGQPENLVAMVLRLQANHVWIREQLTHLQRRLVTLRLDK
QRSLYEGKERLQRLLLSLQVKHGRHWAL*
IP03233.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:58:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12589-PC | 96 | CG12589-PC | 1..96 | 33..128 | 494 | 100 | Plus |
CG12589-PB | 96 | CG12589-PB | 1..96 | 33..128 | 494 | 100 | Plus |
CG12589-PA | 96 | CG12589-PA | 1..96 | 33..128 | 494 | 100 | Plus |
IP03233.pep Sequence
Translation from 96 to 386
> IP03233.pep
MDAHSTAVAGIDMELDFGEDMDEHGELEKVGQPENLVAMVLRLQANHVWI
REQLTHLQRRLVTLRLDKQRSLYEGKERLQRLLLSLQVKHGRHWAL*
IP03233.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:02:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF16073-PA | 91 | GF16073-PA | 1..91 | 1..96 | 206 | 53.6 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:02:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG11200-PA | 96 | GG11200-PA | 1..96 | 1..96 | 377 | 89.6 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:02:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG12589-PC | 96 | CG12589-PC | 1..96 | 1..96 | 494 | 100 | Plus |
CG12589-PB | 96 | CG12589-PB | 1..96 | 1..96 | 494 | 100 | Plus |
CG12589-PA | 96 | CG12589-PA | 1..96 | 1..96 | 494 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:02:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM10660-PA | 96 | GM10660-PA | 1..96 | 1..96 | 431 | 88.5 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:02:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ11022-PA | 77 | GJ11022-PA | 1..77 | 21..96 | 162 | 50.6 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:02:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK14291-PA | 95 | GK14291-PA | 1..95 | 1..96 | 170 | 43.4 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:02:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE25310-PA | 96 | GE25310-PA | 1..96 | 1..96 | 366 | 87.5 | Plus |