Clone IP03239 Report

Search the DGRC for IP03239

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:32
Well:39
Vector:pOT2
Associated Gene/TranscriptCG12994-RA
Protein status:IP03239.pep: gold
Preliminary Size:204
Sequenced Size:1187

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12994 2005-01-01 Successful iPCR screen
CG12994 2008-04-29 Release 5.5 accounting
CG12994 2008-08-15 Release 5.9 accounting
CG12994 2008-12-18 5.12 accounting

Clone Sequence Records

IP03239.complete Sequence

1187 bp (1187 high quality bases) assembled on 2004-12-17

GenBank Submission: BT023701

> IP03239.complete
CAGGTCGCCTCCGCAGTCGGCTACTTGATATTCGATACCTGGTAGCTGCG
CTTCGCCGTCGCTCATACGCCCCGTTGGCCCGGTACGAGAAGCACGCACA
GAACGCTAGGAAAGTGCGCCAACTTTCGGGCAAACTGAACTGAATTTGAA
AGTGCGGAAGGATAGGCGTTGTCTGGCCTCTTTGGAGGTCCTGCTGGCGC
CACCGAAAGACCTTGAGAAGCGAAGAGTGCGCCTGCACACATAAATTCCA
ATTAAACAAGGGCAAAGAAATTGAAGAACAGAAGGAGAAACCCAATAAAA
TATCCCAACCAGCTGCAATAGCAACAAATAGCCCGTTGAAACTTTGCTGG
CCAGCGAGCCAAGTAGCCAAACATAAATAAAGGGCGCGCACATTTATTTA
TTACTTGACCCGAACTTTTCGCAAAATGCCAGCGGGTCGAGTGGCTGGCA
AGGCCGGCTACTCCAATCACTACTACAATGGACGCTCCTATGTGGGCATC
AACGAGGAGATCATGTGGGTAAGCATCGGCATGGGCGTGACCATAGTGCT
CCTGATCACGATCGCCTTGTGCTACATTGCGCGCGAGAAGTGCCAGAAGA
GGCAGCGGGAGTACTACGTGACCGCATAGTTGTTGTACGCGGCCTGCCAA
ACGACGGAGCAGCAGGGGCATACCCGGGATGAGGTCATGGGCATGGAGGA
GGGAGCTGGCAAATCGCAGAGCGCTGTCGGGGTTCCTGAGGCCAGTCCCG
GGGGAGTATCACCATCGCCAGCAGGATCACAGGCAGCCGTCACCGTCATG
CATTGGTCTGTGGTCGACATCTGTGCCCGCAGCTGGGGCTGACATGCCCA
CATGGATGTGAAAAACGAAGGAGAGCAGACACCCACGTATGTAAACCACC
AGGGCCACCCAGCCGCCAGACCACAGAACCACCAGCCCATTCCACCCAGC
ACCACCCACCAAAAACCACAATTACTACGGAACCCCATGCGCTTCGCTGC
CCAAGGCAGTTGAATGCGTGAAACTATTTTTTTTTTTTTTTTTGTTGGTC
GTCGTCAAATGTCGCGTGCGAAACTCGTTGTAAGCATATTATATTTAGAG
AAAGTTACTTTAAAATACAAACATGTTACTGAATTTGCCAAATACGAAAT
ATATTAATATACAATATAAAAAAAAAAAAAAAAAAAA

IP03239.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:50:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG12994-RA 1183 CG12994-RA 19..1183 1..1167 5780 99.8 Plus
CG17193-RB 3908 CG17193-RB 609..726 496..616 250 81.8 Plus
CG17193-RA 3940 CG17193-RA 634..751 496..616 250 81.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:22:27
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 17311700..17312385 1167..480 3300 99 Minus
chrX 22417052 chrX 17312451..17312746 481..186 1435 99 Minus
chrX 22417052 chrX 17333166..17333354 189..1 915 98.9 Minus
chr3R 27901430 chr3R 15863550..15863654 600..496 240 81.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:37:11 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:22:25
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 17422316..17423005 1171..480 3380 99.6 Minus
X 23542271 X 17423071..17423366 481..186 1480 100 Minus
X 23542271 X 17443806..17443994 189..1 945 100 Minus
3R 32079331 3R 20039616..20039720 600..496 240 81.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:39:49
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 17430414..17431103 1171..480 3390 99.5 Minus
X 23527363 X 17431169..17431464 481..186 1480 100 Minus
X 23527363 X 17451904..17452092 189..1 945 100 Minus
3R 31820162 3R 19780434..19780551 616..496 250 81.8 Minus
Blast to na_te.dros performed on 2019-03-16 13:22:25 has no hits.

IP03239.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:23:20 Download gff for IP03239.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 17311721..17312384 481..1146 98 <- Minus
chrX 17312452..17312744 188..480 98 <- Minus
chrX 17333168..17333354 1..187 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:53:02 Download gff for IP03239.complete
Subject Subject Range Query Range Percent Splice Strand
CG12994-RA 1..204 426..629 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:21:36 Download gff for IP03239.complete
Subject Subject Range Query Range Percent Splice Strand
CG12994-RA 1..204 426..629 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:18:16 Download gff for IP03239.complete
Subject Subject Range Query Range Percent Splice Strand
CG12994-RA 1..204 426..629 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:05:35 Download gff for IP03239.complete
Subject Subject Range Query Range Percent Splice Strand
CG12994-RA 1..204 426..629 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:18:11 Download gff for IP03239.complete
Subject Subject Range Query Range Percent Splice Strand
CG12994-RA 1..204 426..629 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:53:01 Download gff for IP03239.complete
Subject Subject Range Query Range Percent Splice Strand
CG12994-RA 1..1165 1..1167 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:21:36 Download gff for IP03239.complete
Subject Subject Range Query Range Percent Splice Strand
CG12994-RA 1..1165 1..1167 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:18:16 Download gff for IP03239.complete
Subject Subject Range Query Range Percent Splice Strand
CG12994-RA 1..1165 1..1167 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:05:35 Download gff for IP03239.complete
Subject Subject Range Query Range Percent Splice Strand
CG12994-RA 1..1165 1..1167 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:18:11 Download gff for IP03239.complete
Subject Subject Range Query Range Percent Splice Strand
CG12994-RA 1..1165 1..1167 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:23:20 Download gff for IP03239.complete
Subject Subject Range Query Range Percent Splice Strand
X 17422320..17423004 481..1167 99 <- Minus
X 17423072..17423364 188..480 100 <- Minus
X 17443808..17443994 1..187 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:23:20 Download gff for IP03239.complete
Subject Subject Range Query Range Percent Splice Strand
X 17422320..17423004 481..1167 99 <- Minus
X 17423072..17423364 188..480 100 <- Minus
X 17443808..17443994 1..187 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:23:20 Download gff for IP03239.complete
Subject Subject Range Query Range Percent Splice Strand
X 17422320..17423004 481..1167 99 <- Minus
X 17423072..17423364 188..480 100 <- Minus
X 17443808..17443994 1..187 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:18:16 Download gff for IP03239.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 17316353..17317037 481..1167 99 <- Minus
arm_X 17317105..17317397 188..480 100 <- Minus
arm_X 17337841..17338027 1..187 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:41:56 Download gff for IP03239.complete
Subject Subject Range Query Range Percent Splice Strand
X 17430418..17431102 481..1167 99 <- Minus
X 17431170..17431462 188..480 100 <- Minus
X 17451906..17452092 1..187 100   Minus

IP03239.hyp Sequence

Translation from 425 to 628

> IP03239.hyp
MPAGRVAGKAGYSNHYYNGRSYVGINEEIMWVSIGMGVTIVLLITIALCY
IAREKCQKRQREYYVTA*

IP03239.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:58:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG12994-PA 67 CG12994-PA 1..67 1..67 353 100 Plus
CG17193-PC 68 CG17193-PC 5..68 4..67 216 69.2 Plus
CG17193-PB 68 CG17193-PB 5..68 4..67 216 69.2 Plus
CG17193-PA 68 CG17193-PA 5..68 4..67 216 69.2 Plus

IP03239.pep Sequence

Translation from 425 to 628

> IP03239.pep
MPAGRVAGKAGYSNHYYNGRSYVGINEEIMWVSIGMGVTIVLLITIALCY
IAREKCQKRQREYYVTA*

IP03239.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:48:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22614-PA 67 GF22614-PA 1..67 1..67 342 98.5 Plus
Dana\GF17337-PA 68 GF17337-PA 5..68 4..67 208 69.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:48:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18183-PA 67 GG18183-PA 1..67 1..67 346 100 Plus
Dere\GG15630-PA 68 GG15630-PA 5..68 4..67 208 69.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:48:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24069-PA 67 GH24069-PA 1..67 1..67 342 98.5 Plus
Dgri\GH23219-PA 68 GH23219-PA 5..68 4..67 196 64.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:59:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG12994-PA 67 CG12994-PA 1..67 1..67 353 100 Plus
CG17193-PC 68 CG17193-PC 5..68 4..67 216 69.2 Plus
CG17193-PB 68 CG17193-PB 5..68 4..67 216 69.2 Plus
CG17193-PA 68 CG17193-PA 5..68 4..67 216 69.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:48:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14648-PA 67 GI14648-PA 1..67 1..67 342 98.5 Plus
Dmoj\GI10313-PA 68 GI10313-PA 5..68 4..67 198 64.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:48:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19830-PA 67 GL19830-PA 1..67 1..67 342 98.5 Plus
Dper\GL12517-PA 68 GL12517-PA 27..68 25..67 149 72.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:48:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11962-PA 67 GA11962-PA 1..67 1..67 342 98.5 Plus
Dpse\GA14379-PA 68 GA14379-PA 27..68 25..67 149 72.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:48:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13315-PA 67 GM13315-PA 1..67 1..67 346 100 Plus
Dsec\GM17696-PA 68 GM17696-PA 5..68 4..67 208 69.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:48:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17359-PA 67 GD17359-PA 1..67 1..67 346 100 Plus
Dsim\GD20082-PA 68 GD20082-PA 5..68 4..67 208 69.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:48:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19297-PA 67 GJ19297-PA 1..67 1..67 342 98.5 Plus
Dvir\GJ10167-PA 68 GJ10167-PA 5..68 4..67 196 64.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:48:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19922-PA 147 GK19922-PA 1..60 1..61 276 90.2 Plus
Dwil\GK22794-PA 68 GK22794-PA 5..68 4..67 203 67.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:48:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15593-PA 67 GE15593-PA 1..67 1..67 346 100 Plus
Dyak\GE25089-PA 68 GE25089-PA 5..68 4..67 208 69.2 Plus