Clone IP03249 Report

Search the DGRC for IP03249

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:32
Well:49
Vector:pOT2
Associated Gene/TranscriptCG13306-RA
Protein status:IP03249.pep: gold
Preliminary Size:285
Sequenced Size:549

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13306 2005-01-01 Successful iPCR screen
CG13306 2008-04-29 Release 5.5 accounting
CG13306 2008-08-15 Release 5.9 accounting
CG13306 2008-12-18 5.12 accounting

Clone Sequence Records

IP03249.complete Sequence

549 bp (549 high quality bases) assembled on 2005-03-01

GenBank Submission: BT023184

> IP03249.complete
CAAAGAACTGCCGTAAATGCGAAAATATCTCGAACGCTCTGCGGTAAATA
TTATCTTGTAAAATCAGGAAATCACGAAAAGTGCACTGAGCTCGCCGAAA
AAATAGAATAATGGTTCTGCTACTGGTGCACCTGCGGCGCCTTATTTTGC
TGCTGACGGTCGTTTACCTGAGCGGAGCGGTATTCCGTCGCCTTCTCACC
GAACGGCACCACGCCCACATCCTGCAAGGCAATGGTTACATGGGTTTCGG
ACGTCTTCGTGGTGGCGGTGGATCCAAGGAGCCGTATCACTTCCAATGGT
GGGCCTACATCTACACCTGTTATGCATACGCCGTGCTGGTCAACTACGTC
AACATGCGCCGGCTGACCAACCTTATCGAATTTTTCTTGAATTAATGATT
AATAATTAGAGCAAACGCGATTAAACACATATCGAATTCCCTACGCAACA
CATAGACACCCTTTTAAAGTTACGTTATAACAAACTTATTGTATTAATAG
AAACTTTTTTGTAATTTATTATTTACTTCTTAAAAAAAAAAAAAAAAAA

IP03249.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:51:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG13306-RA 594 CG13306-RA 40..572 1..533 2665 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:39:00
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8741158..8741597 531..92 2065 98 Minus
chr3L 24539361 chr3L 8741656..8741745 90..1 435 98.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:37:12 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:38:58
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8749137..8749581 533..89 2225 100 Minus
3L 28110227 3L 8749637..8749726 90..1 450 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:10:42
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8742237..8742681 533..89 2225 100 Minus
3L 28103327 3L 8742737..8742826 90..1 450 100 Minus
Blast to na_te.dros performed 2019-03-15 15:38:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\Tom 7060 Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). 349..469 527..394 116 62.2 Minus
Dana\Tom 7060 Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). 6935..7055 527..394 116 62.2 Minus

IP03249.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:39:40 Download gff for IP03249.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8741656..8741745 1..90 98   Minus
chr3L 8741158..8741598 91..531 97 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:19:53 Download gff for IP03249.complete
Subject Subject Range Query Range Percent Splice Strand
CG13306-RA 1..285 111..395 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:47:01 Download gff for IP03249.complete
Subject Subject Range Query Range Percent Splice Strand
CG13306-RA 1..285 111..395 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:35:19 Download gff for IP03249.complete
Subject Subject Range Query Range Percent Splice Strand
CG13306-RA 1..285 111..395 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:28:06 Download gff for IP03249.complete
Subject Subject Range Query Range Percent Splice Strand
CG13306-RA 1..285 111..395 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:11:56 Download gff for IP03249.complete
Subject Subject Range Query Range Percent Splice Strand
CG13306-RA 1..285 111..395 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:56:19 Download gff for IP03249.complete
Subject Subject Range Query Range Percent Splice Strand
CG13306-RA 1..531 1..531 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:47:01 Download gff for IP03249.complete
Subject Subject Range Query Range Percent Splice Strand
CG13306-RA 1..531 1..531 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:35:19 Download gff for IP03249.complete
Subject Subject Range Query Range Percent Splice Strand
CG13306-RA 1..531 1..531 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:28:06 Download gff for IP03249.complete
Subject Subject Range Query Range Percent Splice Strand
CG13306-RA 1..531 1..531 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:11:56 Download gff for IP03249.complete
Subject Subject Range Query Range Percent Splice Strand
CG13306-RA 1..531 1..531 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:39:40 Download gff for IP03249.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8749139..8749579 91..531 100 <- Minus
3L 8749637..8749726 1..90 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:39:40 Download gff for IP03249.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8749139..8749579 91..531 100 <- Minus
3L 8749637..8749726 1..90 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:39:40 Download gff for IP03249.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8749139..8749579 91..531 100 <- Minus
3L 8749637..8749726 1..90 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:35:19 Download gff for IP03249.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8742239..8742679 91..531 100 <- Minus
arm_3L 8742737..8742826 1..90 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:02:45 Download gff for IP03249.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8742239..8742679 91..531 100 <- Minus
3L 8742737..8742826 1..90 100   Minus

IP03249.hyp Sequence

Translation from 110 to 394

> IP03249.hyp
MVLLLVHLRRLILLLTVVYLSGAVFRRLLTERHHAHILQGNGYMGFGRLR
GGGGSKEPYHFQWWAYIYTCYAYAVLVNYVNMRRLTNLIEFFLN*

IP03249.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:59:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG13306-PA 94 CG13306-PA 1..94 1..94 502 100 Plus

IP03249.pep Sequence

Translation from 110 to 394

> IP03249.pep
MVLLLVHLRRLILLLTVVYLSGAVFRRLLTERHHAHILQGNGYMGFGRLR
GGGGSKEPYHFQWWAYIYTCYAYAVLVNYVNMRRLTNLIEFFLN*

IP03249.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:41:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20112-PA 92 GF20112-PA 1..92 1..94 327 75.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:41:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15061-PA 94 GG15061-PA 1..94 1..94 462 95.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG13306-PA 94 CG13306-PA 1..94 1..94 502 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:41:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12409-PA 93 GI12409-PA 16..93 16..94 285 75.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:41:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10283-PA 94 GL10283-PA 16..94 16..94 315 77.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:41:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12186-PA 94 GA12186-PA 16..94 16..94 311 75.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:41:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24917-PA 94 GM24917-PA 1..94 1..94 466 96.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:41:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12964-PA 94 GD12964-PA 1..94 1..94 478 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:41:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12301-PA 93 GJ12301-PA 1..93 1..94 363 77.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:41:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21284-PA 94 GE21284-PA 1..94 1..94 476 98.9 Plus