Clone IP03266 Report

Search the DGRC for IP03266

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:32
Well:66
Vector:pOT2
Associated Gene/TranscriptCG34329-RA
Protein status:IP03266.pep:
Preliminary Size:246
Sequenced Size:509

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14189 2005-01-01 Successful iPCR screen
CG34329 2008-04-29 Release 5.5 accounting
CG34329 2008-08-15 Release 5.9 accounting
CG34329 2008-12-18 5.12 accounting

Clone Sequence Records

IP03266.complete Sequence

509 bp (509 high quality bases) assembled on 2005-03-04

GenBank Submission: BT023180

> IP03266.complete
CGGTTTCGGTGTCAGTGCTACTCATCCTTGTTGTCTGGGTGTCCTGTTTC
GGCGAATCAGGCGCAGATTGCTGCTGGACAAAGGCCAAGCTGCTCTTCAC
GATGGGCACAGGATCGTGCGGAATGGTCAATGCCAAGACCACCAAATACG
GATGCGAGGCCACAGTTTGCGCGGATGGAAGAGTGCTCAAGGGCACATAT
TGTGGCGTGGGTTCGTGCAATATCATTGGATGCTTTTGTCGCGGCGGCTG
TCTCACTGGAAACTATGGCGAGTCATTTGTGGAAATAAATAATAGGTATC
AGATCAACTTGATAAGCACCCAAATGAGGCTTGCCAATTTAACAGATACC
GAGGCCTAATTTTAATTTTATTCCATTGAAATCAAAAAAAAAAAAACTTA
ACTTTGAGTAAAATAAAGCGTATCAAACAGATGTTATTTTTACGTGGTAA
AAGTTTCAAGTTTGCTGATTGTTAATATACCTACCAGAGCGATTCGAAAA
AAAAAAAAA

IP03266.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:53:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG34329-RA 505 CG34329-RA 8..505 1..498 2490 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:39:55
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 18939437..18939933 1..496 2435 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:37:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:39:53
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19050480..19050977 1..498 2490 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:42:16
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 19058578..19059075 1..498 2490 100 Plus
Blast to na_te.dros performed on 2019-03-15 15:39:54 has no hits.

IP03266.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:41:09 Download gff for IP03266.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 18939437..18939933 1..496 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:19:56 Download gff for IP03266.complete
Subject Subject Range Query Range Percent Splice Strand
CG34329-RA 8..366 1..359 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:25:23 Download gff for IP03266.complete
Subject Subject Range Query Range Percent Splice Strand
CG34329-RA 8..366 1..359 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:35:37 Download gff for IP03266.complete
Subject Subject Range Query Range Percent Splice Strand
Diedel3-RA 8..366 1..359 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:09:35 Download gff for IP03266.complete
Subject Subject Range Query Range Percent Splice Strand
CG34329-RA 8..366 1..359 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:12:10 Download gff for IP03266.complete
Subject Subject Range Query Range Percent Splice Strand
Diedel3-RA 8..366 1..359 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:27:51 Download gff for IP03266.complete
Subject Subject Range Query Range Percent Splice Strand
CG34329-RA 8..503 1..496 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:25:23 Download gff for IP03266.complete
Subject Subject Range Query Range Percent Splice Strand
CG34329-RA 8..503 1..496 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:35:37 Download gff for IP03266.complete
Subject Subject Range Query Range Percent Splice Strand
Diedel3-RA 8..503 1..496 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:09:36 Download gff for IP03266.complete
Subject Subject Range Query Range Percent Splice Strand
CG34329-RA 8..503 1..496 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:12:10 Download gff for IP03266.complete
Subject Subject Range Query Range Percent Splice Strand
Diedel3-RA 39..534 1..496 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:41:09 Download gff for IP03266.complete
Subject Subject Range Query Range Percent Splice Strand
X 19050480..19050975 1..496 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:41:09 Download gff for IP03266.complete
Subject Subject Range Query Range Percent Splice Strand
X 19050480..19050975 1..496 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:41:09 Download gff for IP03266.complete
Subject Subject Range Query Range Percent Splice Strand
X 19050480..19050975 1..496 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:35:37 Download gff for IP03266.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18944513..18945008 1..496 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:45:55 Download gff for IP03266.complete
Subject Subject Range Query Range Percent Splice Strand
X 19058578..19059073 1..496 100   Plus

IP03266.pep Sequence

Translation from 2 to 358

> IP03266.pep
VSVSVLLILVVWVSCFGESGADCCWTKAKLLFTMGTGSCGMVNAKTTKYG
CEATVCADGRVLKGTYCGVGSCNIIGCFCRGGCLTGNYGESFVEINNRYQ
INLISTQMRLANLTDTEA*

IP03266.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:12:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15938-PA 113 GF15938-PA 6..112 3..109 233 43 Plus
Dana\GF15937-PA 113 GF15937-PA 6..112 3..109 229 41.1 Plus
Dana\GF16013-PA 109 GF16013-PA 9..109 1..104 151 40.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:12:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19205-PA 121 GG19205-PA 4..121 1..118 500 78.8 Plus
Dere\GG11665-PA 115 GG11665-PA 6..111 3..107 200 39.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:45
Subject Length Description Subject Range Query Range Score Percent Strand
Diedel3-PB 121 CG34329-PB 4..121 1..118 641 100 Plus
Diedel3-PA 121 CG34329-PA 4..121 1..118 641 100 Plus
Diedel2-PA 125 CG43228-PA 4..105 6..107 226 37.3 Plus
Diedel-PA 115 CG11501-PA 6..108 3..104 224 41.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:12:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24242-PA 113 GI24242-PA 6..111 4..107 179 39.8 Plus
Dmoj\GI11819-PA 140 GI11819-PA 23..111 18..105 163 36 Plus
Dmoj\GI22343-PA 117 GI22343-PA 47..115 38..105 136 39.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:12:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13593-PA 116 GL13593-PA 5..91 3..84 145 39.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:12:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26837-PA 116 GA26837-PA 5..91 3..84 145 39.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:12:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12788-PA 116 GM12788-PA 5..116 1..110 227 44.6 Plus
Dsec\GM12796-PA 125 GM12796-PA 4..105 6..107 194 36.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:12:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17420-PA 121 GD17420-PA 4..121 1..118 581 94.9 Plus
Dsim\GD21438-PA 116 GD21438-PA 5..116 1..110 216 42.9 Plus
Dsim\GD21443-PA 125 GD21443-PA 4..105 6..107 196 36.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:12:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11856-PA 131 GJ11856-PA 18..102 21..104 165 37.6 Plus
Dvir\GJ11855-PA 131 GJ11855-PA 18..102 21..104 165 37.6 Plus
Dvir\GJ14220-PA 113 GJ14220-PA 25..111 21..105 131 32.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:12:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17767-PA 121 GE17767-PA 19..118 16..115 398 75 Plus
Dyak\GE23861-PA 125 GE23861-PA 4..106 6..108 208 39.8 Plus
Dyak\GE23853-PA 114 GE23853-PA 3..110 2..107 196 41.7 Plus
Dyak\GE23854-PA 115 GE23854-PA 6..111 3..107 183 36.8 Plus

IP03266.hyp Sequence

Translation from 2 to 358

> IP03266.hyp
VSVSVLLILVVWVSCFGESGADCCWTKAKLLFTMGTGSCGMVNAKTTKYG
CEATVCADGRVLKGTYCGVGSCNIIGCFCRGGCLTGNYGESFVEINNRYQ
INLISTQMRLANLTDTEA*

IP03266.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 11:59:46
Subject Length Description Subject Range Query Range Score Percent Strand
Diedel3-PB 121 CG34329-PB 4..121 1..118 641 100 Plus
Diedel3-PA 121 CG34329-PA 4..121 1..118 641 100 Plus
Diedel2-PA 125 CG43228-PA 4..105 6..107 226 37.3 Plus
Diedel-PA 115 CG11501-PA 6..108 3..104 224 41.7 Plus