Clone IP03267 Report

Search the DGRC for IP03267

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:32
Well:67
Vector:pOT2
Associated Gene/Transcriptksh-RB
Protein status:IP03267.pep: gold
Preliminary Size:225
Sequenced Size:448

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14199 2005-01-01 Successful iPCR screen
CG14199 2008-04-29 Release 5.5 accounting
CG14199 2008-08-15 Release 5.9 accounting
CG14199 2008-12-18 5.12 accounting

Clone Sequence Records

IP03267.complete Sequence

448 bp (448 high quality bases) assembled on 2006-05-24

GenBank Submission: BT025895

> IP03267.complete
CCGAGCGGCTGGCACGTCACTAGTTTACCGCTTGTTGTTATTCTATCGCC
AAGCACGGATTTCGATTTGCTAAATCATGAGCGCCCTGTTCAACTTCCAC
AGCCTGCTGTCGGTCATCCTGCTGCTGATCTGCACCTGTGCCTACCTGCG
CTCGCTCTTCCCCAGCTTGATAGACCGCAACAAGACCGGATTCATGGGCA
CCTTCTGGAAGCTGGCAAGGATTGGGGAGCGCAAGTCGCCGTGGGTAGGA
GCCGCCTGCCTGATCATGGCCTTCACCGTTCTCTTTTGGAGCTGAGCTCC
TGCATCCCGCATCCCCTCCAGGAGCCGAATGGCACCATAGATTAGATATT
CCAAACTTTCTAGGACTGTAAATACACGCTGCGTTCTGCAGCACTGGCCG
CACATTTCGGGCTTTCCCAACAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP03267.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:17:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG14199-RB 554 CG14199-RB 76..497 1..422 2110 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:03:38
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 19383219..19383451 421..189 1165 100 Minus
chrX 22417052 chrX 19383526..19383636 189..79 555 100 Minus
chrX 22417052 chrX 19383699..19383777 79..1 395 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:37:19 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:03:36
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19494419..19494652 422..189 1170 100 Minus
X 23542271 X 19494727..19494837 189..79 555 100 Minus
X 23542271 X 19494900..19494978 79..1 395 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:10:47
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 19502517..19502750 422..189 1170 100 Minus
X 23527363 X 19502825..19502935 189..79 555 100 Minus
X 23527363 X 19502998..19503076 79..1 395 100 Minus
Blast to na_te.dros performed on 2019-03-16 05:03:37 has no hits.

IP03267.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:04:34 Download gff for IP03267.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 19383219..19383450 190..421 100 <- Minus
chrX 19383526..19383635 80..189 100 <- Minus
chrX 19383699..19383777 1..79 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:19:57 Download gff for IP03267.complete
Subject Subject Range Query Range Percent Splice Strand
CG14199-RB 1..219 77..295 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:30:14 Download gff for IP03267.complete
Subject Subject Range Query Range Percent Splice Strand
ksh-RB 1..219 77..295 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:14:07 Download gff for IP03267.complete
Subject Subject Range Query Range Percent Splice Strand
ksh-RB 1..219 77..295 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:00:54 Download gff for IP03267.complete
Subject Subject Range Query Range Percent Splice Strand
CG14199-RA 10..225 80..295 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:55:19 Download gff for IP03267.complete
Subject Subject Range Query Range Percent Splice Strand
ksh-RB 1..219 77..295 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-05-27 15:32:46 Download gff for IP03267.complete
Subject Subject Range Query Range Percent Splice Strand
CG14199-RB 1..421 1..421 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:30:14 Download gff for IP03267.complete
Subject Subject Range Query Range Percent Splice Strand
ksh-RB 1..421 1..421 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:14:07 Download gff for IP03267.complete
Subject Subject Range Query Range Percent Splice Strand
ksh-RB 15..435 1..421 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:00:54 Download gff for IP03267.complete
Subject Subject Range Query Range Percent Splice Strand
CG14199-RA 10..225 80..295 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:55:19 Download gff for IP03267.complete
Subject Subject Range Query Range Percent Splice Strand
ksh-RB 15..435 1..421 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:04:34 Download gff for IP03267.complete
Subject Subject Range Query Range Percent Splice Strand
X 19494420..19494651 190..421 100 <- Minus
X 19494727..19494836 80..189 100 <- Minus
X 19494900..19494978 1..79 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:04:34 Download gff for IP03267.complete
Subject Subject Range Query Range Percent Splice Strand
X 19494420..19494651 190..421 100 <- Minus
X 19494727..19494836 80..189 100 <- Minus
X 19494900..19494978 1..79 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:04:34 Download gff for IP03267.complete
Subject Subject Range Query Range Percent Splice Strand
X 19494420..19494651 190..421 100 <- Minus
X 19494727..19494836 80..189 100 <- Minus
X 19494900..19494978 1..79 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:14:07 Download gff for IP03267.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 19388453..19388684 190..421 100 <- Minus
arm_X 19388760..19388869 80..189 100 <- Minus
arm_X 19388933..19389011 1..79 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:55:54 Download gff for IP03267.complete
Subject Subject Range Query Range Percent Splice Strand
X 19502518..19502749 190..421 100 <- Minus
X 19502825..19502934 80..189 100 <- Minus
X 19502998..19503076 1..79 100   Minus

IP03267.hyp Sequence

Translation from 0 to 344

> IP03267.hyp
PSGWHVTSLPLVVILSPSTDFDLLNHERPVQLPQPAVGHPAADLHLCLPA
LALPQLDRPQQDRIHGHLLEAGKDWGAQVAVGRSRLPDHGLHRSLLELSS
CIPHPLQEPNGTID*
Sequence IP03267.hyp has no blast hits.

IP03267.pep Sequence

Translation from 76 to 294

> IP03267.pep
MSALFNFHSLLSVILLLICTCAYLRSLFPSLIDRNKTGFMGTFWKLARIG
ERKSPWVGAACLIMAFTVLFWS*

IP03267.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:53:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20488-PA 84 GF20488-PA 14..84 2..72 333 88.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:53:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18053-PA 107 GG18053-PA 37..107 2..72 306 95.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:53:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17869-PA 72 GH17869-PA 1..72 1..72 295 91.7 Plus
Dgri\GH10654-PA 72 GH10654-PA 1..72 1..72 245 68.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:18:20
Subject Length Description Subject Range Query Range Score Percent Strand
ksh-PB 72 CG14199-PB 1..72 1..72 380 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:53:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16437-PA 71 GI16437-PA 1..71 2..72 296 93 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:53:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14781-PA 83 GL14781-PA 13..83 2..72 291 90.1 Plus
Dper\GL19073-PA 71 GL19073-PA 1..68 2..69 234 61.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:53:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12819-PA 80 GA12819-PA 10..80 2..72 289 90.1 Plus
Dpse\GA25336-PA 71 GA25336-PA 1..68 2..69 235 61.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:53:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22740-PA 74 GM22740-PA 4..74 2..72 352 97.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:53:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15580-PA 74 GD15580-PA 4..74 2..72 357 98.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:53:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18294-PA 73 GJ18294-PA 2..71 1..70 229 74.3 Plus
Dvir\GJ15838-PA 258 GJ15838-PA 225..258 39..72 191 94.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:53:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25511-PA 71 GK25511-PA 1..71 2..72 296 91.5 Plus
Dwil\GK15381-PA 72 GK15381-PA 1..69 1..69 235 62.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:53:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17384-PA 192 GE17384-PA 122..192 2..72 315 95.8 Plus