BDGP Sequence Production Resources |
Search the DGRC for IP03267
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 32 |
Well: | 67 |
Vector: | pOT2 |
Associated Gene/Transcript | ksh-RB |
Protein status: | IP03267.pep: gold |
Preliminary Size: | 225 |
Sequenced Size: | 448 |
Gene | Date | Evidence |
---|---|---|
CG14199 | 2005-01-01 | Successful iPCR screen |
CG14199 | 2008-04-29 | Release 5.5 accounting |
CG14199 | 2008-08-15 | Release 5.9 accounting |
CG14199 | 2008-12-18 | 5.12 accounting |
448 bp (448 high quality bases) assembled on 2006-05-24
GenBank Submission: BT025895
> IP03267.complete CCGAGCGGCTGGCACGTCACTAGTTTACCGCTTGTTGTTATTCTATCGCC AAGCACGGATTTCGATTTGCTAAATCATGAGCGCCCTGTTCAACTTCCAC AGCCTGCTGTCGGTCATCCTGCTGCTGATCTGCACCTGTGCCTACCTGCG CTCGCTCTTCCCCAGCTTGATAGACCGCAACAAGACCGGATTCATGGGCA CCTTCTGGAAGCTGGCAAGGATTGGGGAGCGCAAGTCGCCGTGGGTAGGA GCCGCCTGCCTGATCATGGCCTTCACCGTTCTCTTTTGGAGCTGAGCTCC TGCATCCCGCATCCCCTCCAGGAGCCGAATGGCACCATAGATTAGATATT CCAAACTTTCTAGGACTGTAAATACACGCTGCGTTCTGCAGCACTGGCCG CACATTTCGGGCTTTCCCAACAAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14199-RB | 554 | CG14199-RB | 76..497 | 1..422 | 2110 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chrX | 22417052 | chrX | 19383219..19383451 | 421..189 | 1165 | 100 | Minus |
chrX | 22417052 | chrX | 19383526..19383636 | 189..79 | 555 | 100 | Minus |
chrX | 22417052 | chrX | 19383699..19383777 | 79..1 | 395 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 19383219..19383450 | 190..421 | 100 | <- | Minus |
chrX | 19383526..19383635 | 80..189 | 100 | <- | Minus |
chrX | 19383699..19383777 | 1..79 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14199-RB | 1..219 | 77..295 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ksh-RB | 1..219 | 77..295 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ksh-RB | 1..219 | 77..295 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14199-RA | 10..225 | 80..295 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ksh-RB | 1..219 | 77..295 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14199-RB | 1..421 | 1..421 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ksh-RB | 1..421 | 1..421 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ksh-RB | 15..435 | 1..421 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14199-RA | 10..225 | 80..295 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ksh-RB | 15..435 | 1..421 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 19494420..19494651 | 190..421 | 100 | <- | Minus |
X | 19494727..19494836 | 80..189 | 100 | <- | Minus |
X | 19494900..19494978 | 1..79 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 19494420..19494651 | 190..421 | 100 | <- | Minus |
X | 19494727..19494836 | 80..189 | 100 | <- | Minus |
X | 19494900..19494978 | 1..79 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 19494420..19494651 | 190..421 | 100 | <- | Minus |
X | 19494727..19494836 | 80..189 | 100 | <- | Minus |
X | 19494900..19494978 | 1..79 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 19388453..19388684 | 190..421 | 100 | <- | Minus |
arm_X | 19388760..19388869 | 80..189 | 100 | <- | Minus |
arm_X | 19388933..19389011 | 1..79 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 19502518..19502749 | 190..421 | 100 | <- | Minus |
X | 19502825..19502934 | 80..189 | 100 | <- | Minus |
X | 19502998..19503076 | 1..79 | 100 | Minus |
Translation from 0 to 344
> IP03267.hyp PSGWHVTSLPLVVILSPSTDFDLLNHERPVQLPQPAVGHPAADLHLCLPA LALPQLDRPQQDRIHGHLLEAGKDWGAQVAVGRSRLPDHGLHRSLLELSS CIPHPLQEPNGTID*
Translation from 76 to 294
> IP03267.pep MSALFNFHSLLSVILLLICTCAYLRSLFPSLIDRNKTGFMGTFWKLARIG ERKSPWVGAACLIMAFTVLFWS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF20488-PA | 84 | GF20488-PA | 14..84 | 2..72 | 333 | 88.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG18053-PA | 107 | GG18053-PA | 37..107 | 2..72 | 306 | 95.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH17869-PA | 72 | GH17869-PA | 1..72 | 1..72 | 295 | 91.7 | Plus |
Dgri\GH10654-PA | 72 | GH10654-PA | 1..72 | 1..72 | 245 | 68.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
ksh-PB | 72 | CG14199-PB | 1..72 | 1..72 | 380 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI16437-PA | 71 | GI16437-PA | 1..71 | 2..72 | 296 | 93 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL14781-PA | 83 | GL14781-PA | 13..83 | 2..72 | 291 | 90.1 | Plus |
Dper\GL19073-PA | 71 | GL19073-PA | 1..68 | 2..69 | 234 | 61.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12819-PA | 80 | GA12819-PA | 10..80 | 2..72 | 289 | 90.1 | Plus |
Dpse\GA25336-PA | 71 | GA25336-PA | 1..68 | 2..69 | 235 | 61.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM22740-PA | 74 | GM22740-PA | 4..74 | 2..72 | 352 | 97.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD15580-PA | 74 | GD15580-PA | 4..74 | 2..72 | 357 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ18294-PA | 73 | GJ18294-PA | 2..71 | 1..70 | 229 | 74.3 | Plus |
Dvir\GJ15838-PA | 258 | GJ15838-PA | 225..258 | 39..72 | 191 | 94.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK25511-PA | 71 | GK25511-PA | 1..71 | 2..72 | 296 | 91.5 | Plus |
Dwil\GK15381-PA | 72 | GK15381-PA | 1..69 | 1..69 | 235 | 62.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE17384-PA | 192 | GE17384-PA | 122..192 | 2..72 | 315 | 95.8 | Plus |