Clone IP03279 Report

Search the DGRC for IP03279

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:32
Well:79
Vector:pOT2
Associated Gene/Transcripte(y)2b-RA
Protein status:IP03279.pep: gold
Preliminary Size:288
Sequenced Size:577

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14612 2005-01-01 Successful iPCR screen
CG14612 2008-04-29 Release 5.5 accounting
CG14612 2008-08-15 Release 5.9 accounting
CG14612 2008-12-18 5.12 accounting

Clone Sequence Records

IP03279.complete Sequence

577 bp (577 high quality bases) assembled on 2004-12-17

GenBank Submission: BT023702

> IP03279.complete
CTGCATTTGATTTCCAAACGAATTTTACCGACTCGGGCTTAAGTACTTTT
CAAAATACACGAGATAATCGAATTAAAACTCGAACCATGACAATAAACAA
GGAAACGGGAACCGATCCCGATCCTGGATATAAGCCTACGTTACGCAGTC
AAGATAAGGCCGCCCTGAAGGAACTGCTGCACACGCGTCTTGTGGAGTGC
GGATGGCACAAGGACATTAAGGAAATGATACGAAACATCATCATGGAGCG
CGGAGTGGACAATATAAACCGCGACCAACTGGCTGCCCAAATAGTCCCGC
AAGCTCGCGCTTTGGTGCCTGAAGTCGTCAAAAATGAGATGATGCTGCGC
GTGCACGCCGCCCTCGATAAGTAGTGACTGCCCATCGGTTCCATCCTTAA
CCTTAACCTTAAAAAATCACGTGTTCTAAATTCTAGCACGTGTTTGTGGT
TTATTATCGAATTTAAGTAGATATTTACATACTTATGCTAGCTATGAATT
GCGGCATTAGTTATACAATACGCATATAATAAATAAACAATAAACAACTA
CAATTAGTTAAAAAAAAAAAAAAAAAA

IP03279.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:50:32
Subject Length Description Subject Range Query Range Score Percent Strand
e(y)2b-RA 662 e(y)2b-RA 104..662 1..559 2795 100 Plus
Alh-RC 5255 Alh-RC 5123..5255 560..428 665 100 Minus
Alh-RI 5320 Alh-RI 5188..5320 560..428 665 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:42:54
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 2920507..2920763 303..559 1285 100 Plus
chr3R 27901430 chr3R 2920074..2920236 1..163 815 100 Plus
chr3R 27901430 chr3R 2920299..2920438 164..303 700 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:37:22 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:42:52
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7094471..7094728 303..560 1290 100 Plus
3R 32079331 3R 7094038..7094200 1..163 815 100 Plus
3R 32079331 3R 7094263..7094402 164..303 700 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:39:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 6835302..6835559 303..560 1290 100 Plus
3R 31820162 3R 6834869..6835031 1..163 815 100 Plus
3R 31820162 3R 6835094..6835233 164..303 700 100 Plus
Blast to na_te.dros performed on 2019-03-16 13:42:53 has no hits.

IP03279.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:44:00 Download gff for IP03279.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 2920299..2920437 164..302 100 -> Plus
chr3R 2920507..2920763 303..559 100   Plus
chr3R 2920074..2920236 1..163 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:20:00 Download gff for IP03279.complete
Subject Subject Range Query Range Percent Splice Strand
CG14612-RA 1..288 87..374 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:21:37 Download gff for IP03279.complete
Subject Subject Range Query Range Percent Splice Strand
e(y)2b-RA 1..288 87..374 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 14:32:34 Download gff for IP03279.complete
Subject Subject Range Query Range Percent Splice Strand
e(y)2b-RA 1..288 87..374 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:05:36 Download gff for IP03279.complete
Subject Subject Range Query Range Percent Splice Strand
CG14612-RA 1..288 87..374 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:18:50 Download gff for IP03279.complete
Subject Subject Range Query Range Percent Splice Strand
e(y)2b-RA 1..288 87..374 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:22:33 Download gff for IP03279.complete
Subject Subject Range Query Range Percent Splice Strand
CG14612-RA 1..288 87..374 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:21:37 Download gff for IP03279.complete
Subject Subject Range Query Range Percent Splice Strand
e(y)2b-RA 1..559 1..559 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 14:32:34 Download gff for IP03279.complete
Subject Subject Range Query Range Percent Splice Strand
e(y)2b-RA 1..559 1..559 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:05:36 Download gff for IP03279.complete
Subject Subject Range Query Range Percent Splice Strand
CG14612-RA 1..288 87..374 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:18:50 Download gff for IP03279.complete
Subject Subject Range Query Range Percent Splice Strand
e(y)2b-RA 1..559 1..559 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:44:00 Download gff for IP03279.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7094038..7094200 1..163 100 -> Plus
3R 7094263..7094401 164..302 100 -> Plus
3R 7094471..7094727 303..559 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:44:00 Download gff for IP03279.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7094038..7094200 1..163 100 -> Plus
3R 7094263..7094401 164..302 100 -> Plus
3R 7094471..7094727 303..559 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:44:00 Download gff for IP03279.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7094038..7094200 1..163 100 -> Plus
3R 7094263..7094401 164..302 100 -> Plus
3R 7094471..7094727 303..559 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 14:32:34 Download gff for IP03279.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2919760..2919922 1..163 100 -> Plus
arm_3R 2919985..2920123 164..302 100 -> Plus
arm_3R 2920193..2920449 303..559 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:41:57 Download gff for IP03279.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6835302..6835558 303..559 100   Plus
3R 6834869..6835031 1..163 100 -> Plus
3R 6835094..6835232 164..302 100 -> Plus

IP03279.hyp Sequence

Translation from 2 to 373

> IP03279.hyp
AFDFQTNFTDSGLSTFQNTRDNRIKTRTMTINKETGTDPDPGYKPTLRSQ
DKAALKELLHTRLVECGWHKDIKEMIRNIIMERGVDNINRDQLAAQIVPQ
ARALVPEVVKNEMMLRVHAALDK*

IP03279.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:00:25
Subject Length Description Subject Range Query Range Score Percent Strand
e(y)2b-PB 95 CG14612-PB 1..95 29..123 490 100 Plus
e(y)2b-PA 95 CG14612-PA 1..95 29..123 490 100 Plus
e(y)2-PA 101 CG15191-PA 11..87 46..121 181 41.6 Plus

IP03279.pep Sequence

Translation from 86 to 373

> IP03279.pep
MTINKETGTDPDPGYKPTLRSQDKAALKELLHTRLVECGWHKDIKEMIRN
IIMERGVDNINRDQLAAQIVPQARALVPEVVKNEMMLRVHAALDK*

IP03279.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:49:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17650-PA 102 GF17650-PA 1..94 1..94 274 56.4 Plus
Dana\GF20364-PA 100 GF20364-PA 11..87 18..93 169 37.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:49:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13819-PA 101 GG13819-PA 1..94 1..94 305 63.8 Plus
Dere\GG18848-PA 101 GG18848-PA 11..87 18..93 179 37.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:49:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19002-PA 102 GH19002-PA 1..95 1..93 249 52.6 Plus
Dgri\GH11892-PA 94 GH11892-PA 11..87 18..93 178 39 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:11:48
Subject Length Description Subject Range Query Range Score Percent Strand
e(y)2b-PB 95 CG14612-PB 1..95 1..95 490 100 Plus
e(y)2b-PA 95 CG14612-PA 1..95 1..95 490 100 Plus
e(y)2-PA 101 CG15191-PA 11..87 18..93 181 41.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:49:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23058-PA 112 GI23058-PA 1..94 1..94 239 50 Plus
Dmoj\GI15902-PA 94 GI15902-PA 11..87 18..93 173 39 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:49:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12417-PA 102 GL12417-PA 1..96 1..94 215 46.9 Plus
Dper\GL26889-PA 100 GL26889-PA 9..89 16..95 177 35.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:49:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\e(y)2b-PA 102 GA13111-PA 1..96 1..94 213 45.8 Plus
Dpse\e(y)2-PA 100 GA13559-PA 9..89 16..95 177 35.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:49:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10932-PA 99 GM10932-PA 1..94 1..94 362 75.5 Plus
Dsec\GM13063-PA 101 GM13063-PA 11..87 18..93 183 40.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:49:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19911-PA 99 GD19911-PA 1..94 1..94 351 73.4 Plus
Dsim\GD24533-PA 101 GD24533-PA 11..87 18..93 177 40.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:49:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24569-PA 105 GJ24569-PA 1..95 1..93 254 54.7 Plus
Dvir\GJ18482-PA 100 GJ18482-PA 1..96 1..94 188 36.5 Plus
Dvir\GJ18481-PA 111 GJ18481-PA 10..96 8..94 177 37.9 Plus
Dvir\GJ18487-PA 102 GJ18487-PA 41..98 37..94 170 51.7 Plus
Dvir\GJ16811-PA 95 GJ16811-PA 11..88 18..93 168 37.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:49:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11231-PA 102 GK11231-PA 1..93 1..93 252 54.8 Plus
Dwil\GK16303-PA 119 GK16303-PA 11..93 18..93 170 36.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:49:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24901-PA 102 GE24901-PA 1..94 1..94 306 63.8 Plus
Dyak\GE14777-PA 102 GE14777-PA 1..94 1..94 306 63.8 Plus
Dyak\GE17290-PA 101 GE17290-PA 11..87 18..93 180 39 Plus