Clone IP03283 Report

Search the DGRC for IP03283

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:32
Well:83
Vector:pOT2
Associated Gene/TranscriptI-t-RA
Protein status:IP03283.pep: gold
Preliminary Size:1317
Sequenced Size:901

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14719 2005-01-01 Successful iPCR screen
I-t 2008-04-29 Release 5.5 accounting
I-t 2008-08-15 Release 5.9 accounting
I-t 2008-12-18 5.12 accounting

Clone Sequence Records

IP03283.complete Sequence

901 bp (901 high quality bases) assembled on 2004-12-17

GenBank Submission: BT023699

> IP03283.complete
CAACAAGGCAATCTCACACACAAAACATAAATACCTAAACACAATGCATA
AGAACTTCAAAAGTCTGCAAAACACTAACCCATCCAATATGAAGAAGGCC
AAAACCGCGGCTAAGGGATTTCCCATTCACCTTGGTTTTTATAGGAACCC
CAGCGAGTATGACGATCGCACGACCACCAATCGCGATTATGGATTGAAAA
GTTCCAAGGGTTCTGGAACGCCATTTCCGCAAAAACAAAAGAAATTAGAT
ACGGCGGCACTAACGGCCAAGTTGGAGACGGATAGTCTGCTCCGATCTGA
ATTAAGCGACTTATCGATTGTCATCTCCGAAAGAAAGGCGTCCTCAGAAC
CACAAGTGGCATCCAATACTACAACCGAACCAACGTTTGAGATGAGACGA
AAGCTTTTTGACGAGGCCGAGTTCACCATCTGCAAGGGTCACAAACTGAA
CCAGGACTTCCATCATATAGTCGAAGATGAAAAGCATTTTAACAAAAGGC
AGAGTGCCAAGGATAACATTCCCTATAGCAATTTCATGGATCTGAAGAAC
TTCTGCGACCAGAACAACATAAAATTTTCCAAGGGTTTTGACGGTTAGCG
TTCCACTGTTGTCATCGAATTAGGAGCGGGAATAAAGTGCAGGAGTCGGG
AATTCCATCTTCGCATCTCCAACATCACCATTTCCACCATCTGTCCCTCT
TGAAAGTGTCACTCACGGAGGATAAATGGTGCCAAGTGCAGCAGAAAAAC
CAGGATGCTAGGTTTGTGAGGAGGCCCGACTGGGAGATACCTGCTATACA
CTTTTCCAACTGCAAAGAATTACATGGTACTCAATTCAATAATTCAATAA
TAAAGGGTTCCTATCTTATACATGTGCAATAAACGAAAAAAAAAAAAAAA
A

IP03283.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:50:33
Subject Length Description Subject Range Query Range Score Percent Strand
I-t-RA 1317 I-t-RA 407..1296 1..888 4395 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 17:56:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 7529571..7530455 3..885 4345 99.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:37:23 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 17:56:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11704030..11704919 1..888 4385 99.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:39:51
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 11444861..11445750 1..888 4395 99.7 Plus
Blast to na_te.dros performed on 2019-03-16 17:56:07 has no hits.

IP03283.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 17:57:05 Download gff for IP03283.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 7529567..7530455 1..885 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:20:01 Download gff for IP03283.complete
Subject Subject Range Query Range Percent Splice Strand
I-t-RA 1..555 44..598 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:21:38 Download gff for IP03283.complete
Subject Subject Range Query Range Percent Splice Strand
I-t-RA 1..555 44..598 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:04:01 Download gff for IP03283.complete
Subject Subject Range Query Range Percent Splice Strand
I-t-RA 1..555 44..598 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:05:37 Download gff for IP03283.complete
Subject Subject Range Query Range Percent Splice Strand
I-t-RA 1..555 44..598 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:23:23 Download gff for IP03283.complete
Subject Subject Range Query Range Percent Splice Strand
I-t-RA 1..555 44..598 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:22:35 Download gff for IP03283.complete
Subject Subject Range Query Range Percent Splice Strand
I-t-RA 407..1293 1..885 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:21:38 Download gff for IP03283.complete
Subject Subject Range Query Range Percent Splice Strand
I-t-RA 407..1293 1..885 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:04:01 Download gff for IP03283.complete
Subject Subject Range Query Range Percent Splice Strand
I-t-RA 1..887 1..885 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:05:37 Download gff for IP03283.complete
Subject Subject Range Query Range Percent Splice Strand
I-t-RA 407..1293 1..885 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:23:23 Download gff for IP03283.complete
Subject Subject Range Query Range Percent Splice Strand
I-t-RA 1..887 1..885 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:57:05 Download gff for IP03283.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11704030..11704916 1..885 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:57:05 Download gff for IP03283.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11704030..11704916 1..885 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 17:57:05 Download gff for IP03283.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11704030..11704916 1..885 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:04:01 Download gff for IP03283.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7529752..7530638 1..885 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:41:58 Download gff for IP03283.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11444861..11445747 1..885 99   Plus

IP03283.hyp Sequence

Translation from 0 to 597

> IP03283.hyp
NKAISHTKHKYLNTMHKNFKSLQNTNPSNMKKAKTAAKGFPIHLGFYRNP
SEYDDRTTTNRDYGLKSSKGSGTPFPQKQKKLDTAALTAKLETDSLLRSE
LSDLSIVISERKASSEPQVASNTTTEPTFEMRRKLFDEAEFTICKGHKLN
QDFHHIVEDEKHFNKRQSAKDNIPYSNFMDLKNFCDQNNIKFSKGFDG*

IP03283.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:00:29
Subject Length Description Subject Range Query Range Score Percent Strand
I-t-PA 184 CG14719-PA 1..184 15..198 968 100 Plus
CG5509-PA 139 CG5509-PA 23..139 61..194 167 32.8 Plus

IP03283.pep Sequence

Translation from 43 to 597

> IP03283.pep
MHKNFKSLQNTNPSNMKKAKTAAKGFPIHLGFYRNPSEYDDRTTTNRDYG
LKSSKGSGTPFPQKQKKLDTAALTAKLETDSLLRSELSDLSIVISERKAS
SEPQVASNTTTEPTFEMRRKLFDEAEFTICKGHKLNQDFHHIVEDEKHFN
KRQSAKDNIPYSNFMDLKNFCDQNNIKFSKGFDG*

IP03283.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:49:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18394-PA 168 GF18394-PA 2..167 18..179 183 31.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:49:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18388-PA 172 GG18388-PA 1..171 8..178 516 58.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:06:58
Subject Length Description Subject Range Query Range Score Percent Strand
I-t-PA 184 CG14719-PA 1..184 1..184 968 100 Plus
CG5509-PA 139 CG5509-PA 23..139 47..180 167 32.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:49:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA30219-PA 184 GA30219-PA 39..181 47..184 141 33.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:49:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23973-PA 185 GM23973-PA 1..185 1..184 790 82.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:49:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18778-PA 185 GD18778-PA 1..185 1..184 802 82.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:49:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11099-PA 208 GK11099-PA 2..201 7..183 197 32.7 Plus
Dwil\GK11992-PA 229 GK11992-PA 36..228 17..183 174 29.4 Plus
Dwil\GK24891-PA 168 GK24891-PA 6..152 57..181 147 35.1 Plus
Dwil\GK18127-PA 175 GK18127-PA 19..170 47..182 137 28.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:49:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24197-PA 167 GE24197-PA 1..166 8..178 488 57 Plus