Clone IP03340 Report

Search the DGRC for IP03340

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:33
Well:40
Vector:pOT2
Associated Gene/TranscriptCG13018-RA
Protein status:IP03340.pep: gold
Preliminary Size:240
Sequenced Size:390

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13018 2005-01-01 Successful iPCR screen
CG13018 2008-04-29 Release 5.5 accounting
CG13018 2008-08-15 Release 5.9 accounting
CG13018 2008-12-18 5.12 accounting

Clone Sequence Records

IP03340.complete Sequence

390 bp (390 high quality bases) assembled on 2005-03-04

GenBank Submission: BT023177

> IP03340.complete
CTGTCCAGTGGTTTTATAACTGGTCCACAAAATAATCAAAAATATAAATT
AATATATCGCTGTATACATACGAAAATGATGCGCTACGAGGGCAACGAGA
GGCTGGCCGATGAGACAGCGTGCGCGGGAGTACGTGCGGATCTCAAGATG
TGCCTCCTGGAGAGCGACTGCTGCAAAATGGGCAAAACGCCGCGCCAGTG
CCTCCAGGACAACAACGTTCCAGCTGAGTGCCAGGTGCTCCGCAATACCT
TCTACGAGTGCAAGCGCTCCCTGTTGGACAACCGACAGCGCTTTCGAGGT
CGCAAGGGCTACTGAGTTTTAAACTTAAATTATATTTTTAAGCGCTTAAA
ATACAAAAAATTACAGACATAAAAAAAAAAAAAAAAAAAA

IP03340.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:51:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG13018-RA 577 CG13018-RA 208..577 1..370 1850 100 Plus
pea-RA 3896 pea-RA 3837..3896 373..314 300 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:41:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10044524..10044800 277..1 1370 99.6 Minus
chr2R 21145070 chr2R 10044371..10044468 370..273 490 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:37:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:41:13
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14157203..14157479 277..1 1370 99.6 Minus
2R 25286936 2R 14157047..14157147 373..273 505 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:10:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14158402..14158678 277..1 1370 99.6 Minus
2R 25260384 2R 14158246..14158346 373..273 505 100 Minus
Blast to na_te.dros performed 2019-03-16 13:41:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\Tom 7060 Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). 6381..6458 111..32 107 61.3 Minus
Dbuz\BuT5 669 Dbuz\BuT5 BUT5 669bp 138..169 332..363 106 81.2 Plus
gypsy11 4428 gypsy11 GYPSY11 4428bp 1052..1077 280..305 103 88.5 Plus

IP03340.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:42:13 Download gff for IP03340.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10044371..10044467 274..370 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:20:12 Download gff for IP03340.complete
Subject Subject Range Query Range Percent Splice Strand
CG13018-RA 1..240 76..315 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:46:56 Download gff for IP03340.complete
Subject Subject Range Query Range Percent Splice Strand
CG13018-RA 1..240 76..315 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:21:52 Download gff for IP03340.complete
Subject Subject Range Query Range Percent Splice Strand
CG13018-RA 1..240 76..315 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:28:01 Download gff for IP03340.complete
Subject Subject Range Query Range Percent Splice Strand
CG13018-RA 1..240 76..315 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:23:47 Download gff for IP03340.complete
Subject Subject Range Query Range Percent Splice Strand
CG13018-RA 1..240 76..315 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:56:11 Download gff for IP03340.complete
Subject Subject Range Query Range Percent Splice Strand
CG13018-RA 1..240 76..315 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:46:56 Download gff for IP03340.complete
Subject Subject Range Query Range Percent Splice Strand
CG13018-RA 1..370 1..370 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:21:52 Download gff for IP03340.complete
Subject Subject Range Query Range Percent Splice Strand
CG13018-RA 10..379 1..370 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:28:01 Download gff for IP03340.complete
Subject Subject Range Query Range Percent Splice Strand
CG13018-RA 1..240 76..315 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:23:47 Download gff for IP03340.complete
Subject Subject Range Query Range Percent Splice Strand
CG13018-RA 10..379 1..370 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:42:13 Download gff for IP03340.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14157050..14157146 274..370 100 <- Minus
2R 14157207..14157479 1..273 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:42:13 Download gff for IP03340.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14157050..14157146 274..370 100 <- Minus
2R 14157207..14157479 1..273 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:42:13 Download gff for IP03340.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14157050..14157146 274..370 100 <- Minus
2R 14157207..14157479 1..273 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:21:52 Download gff for IP03340.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10044555..10044651 274..370 100 <- Minus
arm_2R 10044712..10044984 1..273 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:02:26 Download gff for IP03340.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14158406..14158678 1..273 100   Minus
2R 14158249..14158345 274..370 100 <- Minus

IP03340.hyp Sequence

Translation from 0 to 314

> IP03340.hyp
LSSGFITGPQNNQKYKLIYRCIHTKMMRYEGNERLADETACAGVRADLKM
CLLESDCCKMGKTPRQCLQDNNVPAECQVLRNTFYECKRSLLDNRQRFRG
RKGY*

IP03340.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:01:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG13018-PA 79 CG13018-PA 1..79 26..104 432 100 Plus

IP03340.pep Sequence

Translation from 75 to 314

> IP03340.pep
MMRYEGNERLADETACAGVRADLKMCLLESDCCKMGKTPRQCLQDNNVPA
ECQVLRNTFYECKRSLLDNRQRFRGRKGY*

IP03340.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:40:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12904-PA 80 GF12904-PA 1..80 1..79 377 92.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:40:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22444-PA 79 GG22444-PA 1..79 1..79 409 98.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:40:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23123-PA 80 GH23123-PA 1..80 1..79 358 86.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG13018-PA 79 CG13018-PA 1..79 1..79 432 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:40:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18462-PA 80 GI18462-PA 1..80 1..79 371 90 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:40:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10830-PA 80 GL10830-PA 1..80 1..79 372 91.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:40:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24504-PA 80 GA24504-PA 1..80 1..79 372 91.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:40:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20230-PA 79 GM20230-PA 1..79 1..79 409 98.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:40:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21319-PA 80 GJ21319-PA 1..80 1..79 375 91.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:40:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22128-PA 80 GK22128-PA 1..80 1..79 370 88.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:40:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12335-PA 79 GE12335-PA 1..79 1..79 409 98.7 Plus