BDGP Sequence Production Resources |
Search the DGRC for IP03341
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 33 |
Well: | 41 |
Vector: | pOT2 |
Associated Gene/Transcript | CG13038-RA |
Protein status: | IP03341.pep: gold |
Preliminary Size: | 252 |
Sequenced Size: | 502 |
Gene | Date | Evidence |
---|---|---|
CG13038 | 2005-01-01 | Successful iPCR screen |
CG13038 | 2008-04-29 | Release 5.5 accounting |
CG13038 | 2008-08-15 | Release 5.9 accounting |
CG13038 | 2008-12-18 | 5.12 accounting |
502 bp (502 high quality bases) assembled on 2005-03-04
GenBank Submission: BT023172
> IP03341.complete CCGCCTTGTGTTTGTTACTTGAAAGGGGAACCTCCAGTCCTCGCTTCCAT TCGATCCGTTCCGCCCACCTCAGTTCGTGGTCCGTGGTGTTCTCAGTGAT TTACCCTCTCCATAGTCAACCCATTGGGCTTGGATCGATACCATGCGGCA TCTGTTGCTTCTGGCCTTAGTTTACATGGCTCTGGTTTTGGCCAAACCGG CGACGGAGGCGCCTCGTCTGCTCATCGATTCAGCGCCCTCAGTGGTCTCC TACCAGGGTTCCTCACAGGCCCAAACCCGCTTCGTCATCGCGCCCATGGG CCGATCATTGGGCTACGTGGAGCCCACCAATCTCAATCGAACCTTTCACA CGAAGGCAACGCAGGAGGGAGGCGCCACCGGCTACGAGCAGCTCAATCTG AGTCCGGTCTACGTGCCGGGTAGCTAGGCAATGGAATCGCATAGTTTTAG TTAGTTAAATGTGTAAATAAAGGCAGCGTGTATAACAAAAAAAAAAAAAA AA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13038-RA | 700 | CG13038-RA | 210..700 | 1..491 | 2455 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 16316987..16317318 | 155..486 | 98 | <- | Minus |
chr3L | 16317447..16317600 | 1..154 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13038-RA | 1..285 | 143..427 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13038-RA | 1..285 | 143..427 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13038-RA | 1..285 | 143..427 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13038-RA | 1..285 | 143..427 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13038-RA | 1..285 | 143..427 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13038-RA | 1..486 | 1..486 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13038-RA | 1..486 | 1..486 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13038-RA | 24..509 | 1..486 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13038-RA | 1..486 | 1..486 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13038-RA | 24..509 | 1..486 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16327258..16327589 | 155..486 | 100 | <- | Minus |
3L | 16327717..16327870 | 1..154 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16327258..16327589 | 155..486 | 100 | <- | Minus |
3L | 16327717..16327870 | 1..154 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16327258..16327589 | 155..486 | 100 | <- | Minus |
3L | 16327717..16327870 | 1..154 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 16320358..16320689 | 155..486 | 100 | <- | Minus |
arm_3L | 16320817..16320970 | 1..154 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 16320358..16320689 | 155..486 | 100 | <- | Minus |
3L | 16320817..16320970 | 1..154 | 100 | Minus |
Translation from 142 to 426
> IP03341.hyp MRHLLLLALVYMALVLAKPATEAPRLLIDSAPSVVSYQGSSQAQTRFVIA PMGRSLGYVEPTNLNRTFHTKATQEGGATGYEQLNLSPVYVPGS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13038-PA | 94 | CG13038-PA | 1..94 | 1..94 | 472 | 100 | Plus |
Translation from 142 to 426
> IP03341.pep MRHLLLLALVYMALVLAKPATEAPRLLIDSAPSVVSYQGSSQAQTRFVIA PMGRSLGYVEPTNLNRTFHTKATQEGGATGYEQLNLSPVYVPGS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF10292-PA | 95 | GF10292-PA | 3..95 | 2..94 | 423 | 87.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG13464-PA | 94 | GG13464-PA | 1..94 | 1..94 | 459 | 92.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15601-PA | 83 | GH15601-PA | 18..83 | 23..92 | 246 | 71.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13038-PA | 94 | CG13038-PA | 1..94 | 1..94 | 472 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI16879-PA | 90 | GI16879-PA | 24..90 | 26..92 | 261 | 73.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL18005-PA | 94 | GL18005-PA | 1..92 | 1..92 | 344 | 81.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11992-PA | 94 | GA11992-PA | 1..92 | 1..92 | 344 | 81.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM24413-PA | 94 | GM24413-PA | 1..94 | 1..94 | 476 | 97.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD12483-PA | 94 | GD12483-PA | 1..94 | 1..94 | 462 | 94.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12628-PA | 89 | GJ12628-PA | 22..89 | 25..92 | 252 | 70.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19290-PA | 101 | GK19290-PA | 2..98 | 4..91 | 280 | 63.9 | Plus |