Clone IP03341 Report

Search the DGRC for IP03341

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:33
Well:41
Vector:pOT2
Associated Gene/TranscriptCG13038-RA
Protein status:IP03341.pep: gold
Preliminary Size:252
Sequenced Size:502

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13038 2005-01-01 Successful iPCR screen
CG13038 2008-04-29 Release 5.5 accounting
CG13038 2008-08-15 Release 5.9 accounting
CG13038 2008-12-18 5.12 accounting

Clone Sequence Records

IP03341.complete Sequence

502 bp (502 high quality bases) assembled on 2005-03-04

GenBank Submission: BT023172

> IP03341.complete
CCGCCTTGTGTTTGTTACTTGAAAGGGGAACCTCCAGTCCTCGCTTCCAT
TCGATCCGTTCCGCCCACCTCAGTTCGTGGTCCGTGGTGTTCTCAGTGAT
TTACCCTCTCCATAGTCAACCCATTGGGCTTGGATCGATACCATGCGGCA
TCTGTTGCTTCTGGCCTTAGTTTACATGGCTCTGGTTTTGGCCAAACCGG
CGACGGAGGCGCCTCGTCTGCTCATCGATTCAGCGCCCTCAGTGGTCTCC
TACCAGGGTTCCTCACAGGCCCAAACCCGCTTCGTCATCGCGCCCATGGG
CCGATCATTGGGCTACGTGGAGCCCACCAATCTCAATCGAACCTTTCACA
CGAAGGCAACGCAGGAGGGAGGCGCCACCGGCTACGAGCAGCTCAATCTG
AGTCCGGTCTACGTGCCGGGTAGCTAGGCAATGGAATCGCATAGTTTTAG
TTAGTTAAATGTGTAAATAAAGGCAGCGTGTATAACAAAAAAAAAAAAAA
AA

IP03341.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:53:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG13038-RA 700 CG13038-RA 210..700 1..491 2455 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 23:52:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16316987..16317319 486..154 1575 98.2 Minus
chr3L 24539361 chr3L 16317447..16317600 154..1 770 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:37:40 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 23:52:11
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16327248..16327590 496..154 1715 100 Minus
3L 28110227 3L 16327717..16327870 154..1 770 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:42:04
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16320348..16320690 496..154 1715 100 Minus
3L 28103327 3L 16320817..16320970 154..1 770 100 Minus
Blast to na_te.dros performed on 2019-03-15 23:52:12 has no hits.

IP03341.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 23:53:24 Download gff for IP03341.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16316987..16317318 155..486 98 <- Minus
chr3L 16317447..16317600 1..154 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:20:15 Download gff for IP03341.complete
Subject Subject Range Query Range Percent Splice Strand
CG13038-RA 1..285 143..427 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:25:03 Download gff for IP03341.complete
Subject Subject Range Query Range Percent Splice Strand
CG13038-RA 1..285 143..427 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:09:02 Download gff for IP03341.complete
Subject Subject Range Query Range Percent Splice Strand
CG13038-RA 1..285 143..427 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:09:14 Download gff for IP03341.complete
Subject Subject Range Query Range Percent Splice Strand
CG13038-RA 1..285 143..427 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:50:03 Download gff for IP03341.complete
Subject Subject Range Query Range Percent Splice Strand
CG13038-RA 1..285 143..427 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:27:22 Download gff for IP03341.complete
Subject Subject Range Query Range Percent Splice Strand
CG13038-RA 1..486 1..486 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:25:03 Download gff for IP03341.complete
Subject Subject Range Query Range Percent Splice Strand
CG13038-RA 1..486 1..486 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:09:02 Download gff for IP03341.complete
Subject Subject Range Query Range Percent Splice Strand
CG13038-RA 24..509 1..486 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:09:14 Download gff for IP03341.complete
Subject Subject Range Query Range Percent Splice Strand
CG13038-RA 1..486 1..486 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:50:03 Download gff for IP03341.complete
Subject Subject Range Query Range Percent Splice Strand
CG13038-RA 24..509 1..486 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:53:24 Download gff for IP03341.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16327258..16327589 155..486 100 <- Minus
3L 16327717..16327870 1..154 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:53:24 Download gff for IP03341.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16327258..16327589 155..486 100 <- Minus
3L 16327717..16327870 1..154 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 23:53:24 Download gff for IP03341.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16327258..16327589 155..486 100 <- Minus
3L 16327717..16327870 1..154 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:09:02 Download gff for IP03341.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16320358..16320689 155..486 100 <- Minus
arm_3L 16320817..16320970 1..154 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:45:34 Download gff for IP03341.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16320358..16320689 155..486 100 <- Minus
3L 16320817..16320970 1..154 100   Minus

IP03341.hyp Sequence

Translation from 142 to 426

> IP03341.hyp
MRHLLLLALVYMALVLAKPATEAPRLLIDSAPSVVSYQGSSQAQTRFVIA
PMGRSLGYVEPTNLNRTFHTKATQEGGATGYEQLNLSPVYVPGS*

IP03341.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:01:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG13038-PA 94 CG13038-PA 1..94 1..94 472 100 Plus

IP03341.pep Sequence

Translation from 142 to 426

> IP03341.pep
MRHLLLLALVYMALVLAKPATEAPRLLIDSAPSVVSYQGSSQAQTRFVIA
PMGRSLGYVEPTNLNRTFHTKATQEGGATGYEQLNLSPVYVPGS*

IP03341.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:10:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10292-PA 95 GF10292-PA 3..95 2..94 423 87.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:10:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13464-PA 94 GG13464-PA 1..94 1..94 459 92.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:10:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15601-PA 83 GH15601-PA 18..83 23..92 246 71.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG13038-PA 94 CG13038-PA 1..94 1..94 472 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:10:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16879-PA 90 GI16879-PA 24..90 26..92 261 73.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:10:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18005-PA 94 GL18005-PA 1..92 1..92 344 81.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:10:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11992-PA 94 GA11992-PA 1..92 1..92 344 81.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:10:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24413-PA 94 GM24413-PA 1..94 1..94 476 97.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:10:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12483-PA 94 GD12483-PA 1..94 1..94 462 94.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:10:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12628-PA 89 GJ12628-PA 22..89 25..92 252 70.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:10:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19290-PA 101 GK19290-PA 2..98 4..91 280 63.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:10:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22564-PA 94 GE22564-PA 1..94 1..94 452 91.5 Plus
Dyak\GE22561-PA 94 GE22561-PA 1..94 1..94 452 91.5 Plus