IP03353.complete Sequence
704 bp (704 high quality bases) assembled on 2005-03-04
GenBank Submission: BT023169
> IP03353.complete
CTTATGCTGAGAAGTAAACAAAAGGCGACGAATGTTTGTATTTTCCTAAT
AAAAGCCAATGGAGGATTGGAAATCGGAGGAAATGGCAAGGAAAAGAAAC
AGGAATAGGAGCAAGCAGCGCAGACGAAGGCAGAAAAGTGAGGGAAAGCC
GAAGCCACATACATCTCGAGATCAGTGGAGCAATGTGGCTCAAATATACC
AAAGCCTTTTTGAATGGCACCACAATCATGTTATGAGTCTCTGCCCTGAG
GTTAATCCGAATCTGGATCAGGACCTTGAGGATATTCCCAAGGAAACAGG
AACGTTTCACTGCCTGGACTACGTGTACGAGAGTTCTTCCGAGGATGAGG
AGATCGAACCCATTGACGAAGGCTATCTGAAGTTCCTCGAGGTGACCATT
AAGCATCAGCAGGAACTCAGGGATCGAAGAACTGCCCAAACCACCGACTC
TTTAGATTAGAATTTTGGTAAAATAGGTTTTTACGCAGATGAAAACTTAC
AGTTCATTTTTATCTGGTAATGACTTAAAAATGTATCTTACGTAAAATGT
TATAATTTAAGCTCAAGTTTATAAGTTTGGTATTTAGTTTTGGTAAGCAG
AAAATGTACGTTTTATAGGTGATATTTTTATATGTAGCACTTTGTCTTGA
ACGTATTAAGTATATAAGATGTTTTGATAACTTAAAAAAAAAAAAAAAAA
AAAA
IP03353.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:53:02
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13689-RA | 1009 | CG13689-RA | 72..756 | 1..685 | 3365 | 99.4 | Plus |
CG13689.b | 1681 | CG13689.b | 72..756 | 1..685 | 3365 | 99.4 | Plus |
CG13689.a | 626 | CG13689.a | 135..626 | 192..683 | 2400 | 99.1 | Plus |
CG13689.a | 626 | CG13689.a | 1..137 | 1..137 | 685 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:15:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 603070..603558 | 195..683 | 2370 | 99 | Plus |
chr2L | 23010047 | chr2L | 602809..603002 | 1..194 | 940 | 99 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:37:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:15:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 603074..603564 | 195..685 | 2395 | 99.2 | Plus |
2L | 23513712 | 2L | 602813..603006 | 1..194 | 970 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:41:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 603074..603564 | 195..685 | 2395 | 99.1 | Plus |
2L | 23513712 | 2L | 602813..603006 | 1..194 | 970 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-15 20:15:11 has no hits.
IP03353.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:16:18 Download gff for
IP03353.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 602809..603002 | 1..194 | 98 | -> | Plus |
chr2L | 603070..603558 | 195..683 | 98 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:20:19 Download gff for
IP03353.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13689-RA | 1..402 | 59..460 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:24:28 Download gff for
IP03353.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13689-RA | 1..402 | 59..460 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:05:03 Download gff for
IP03353.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13689-RA | 1..402 | 59..460 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:09:17 Download gff for
IP03353.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13689-RA | 1..402 | 59..460 | 99 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:32:05 Download gff for
IP03353.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13689-RA | 1..402 | 59..460 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:27:25 Download gff for
IP03353.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13689-RA | 1..683 | 1..683 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:24:28 Download gff for
IP03353.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13689-RA | 1..683 | 1..683 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:05:03 Download gff for
IP03353.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13689-RA | 1..683 | 1..683 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:09:17 Download gff for
IP03353.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13689-RA | 1..683 | 1..683 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:32:05 Download gff for
IP03353.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13689-RA | 1..683 | 1..683 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:16:18 Download gff for
IP03353.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 602813..603006 | 1..194 | 100 | -> | Plus |
2L | 603074..603562 | 195..683 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:16:18 Download gff for
IP03353.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 602813..603006 | 1..194 | 100 | -> | Plus |
2L | 603074..603562 | 195..683 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:16:18 Download gff for
IP03353.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 602813..603006 | 1..194 | 100 | -> | Plus |
2L | 603074..603562 | 195..683 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:05:03 Download gff for
IP03353.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 602813..603006 | 1..194 | 100 | -> | Plus |
arm_2L | 603074..603562 | 195..683 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:44:57 Download gff for
IP03353.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 603074..603562 | 195..683 | 99 | | Plus |
2L | 602813..603006 | 1..194 | 100 | -> | Plus |
IP03353.hyp Sequence
Translation from 58 to 459
> IP03353.hyp
MEDWKSEEMARKRNRNRSKQRRRRQKSEGKPKPHTSRDQWSNVAQIYQSL
FEWHHNHVMSLCPEVNPNLDQDLEDIPKETGTFHCLDYVYESSSEDEEIE
PIDEGYLKFLEVTIKHQQELRDRRTAQTTDSLD*
IP03353.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:01:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13689-PA | 133 | CG13689-PA | 1..133 | 1..133 | 719 | 100 | Plus |
CG13689-PB | 114 | CG13689-PB | 1..114 | 1..133 | 583 | 85.7 | Plus |
IP03353.pep Sequence
Translation from 58 to 459
> IP03353.pep
MEDWKSEEMARKRNRNRSKQRRRRQKSEGKPKPHTSRDQWSNVAQIYQSL
FEWHHNHVMSLCPEVNPNLDQDLEDIPKETGTFHCLDYVYESSSEDEEIE
PIDEGYLKFLEVTIKHQQELRDRRTAQTTDSLD*
IP03353.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:11:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF15027-PA | 146 | GF15027-PA | 42..135 | 29..124 | 176 | 50.5 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:11:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG24733-PA | 133 | GG24733-PA | 1..133 | 1..133 | 478 | 91 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13689-PA | 133 | CG13689-PA | 1..133 | 1..133 | 719 | 100 | Plus |
CG13689-PB | 114 | CG13689-PB | 1..114 | 1..133 | 583 | 85.7 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:11:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM16756-PA | 133 | GM16756-PA | 1..133 | 1..133 | 542 | 94.7 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:11:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD23037-PA | 133 | GD23037-PA | 1..133 | 1..133 | 545 | 95.5 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:11:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK24420-PA | 135 | GK24420-PA | 20..121 | 26..131 | 138 | 40.7 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:11:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE16968-PA | 133 | GE16968-PA | 1..133 | 1..133 | 519 | 89.5 | Plus |