Clone IP03353 Report

Search the DGRC for IP03353

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:33
Well:53
Vector:pOT2
Associated Gene/TranscriptCG13689-RA
Protein status:IP03353.pep: gold
Preliminary Size:228
Sequenced Size:704

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13689 2005-01-01 Successful iPCR screen
CG13689 2008-04-29 Release 5.5 accounting
CG13689 2008-08-15 Release 5.9 accounting
CG13689 2008-12-18 5.12 accounting

Clone Sequence Records

IP03353.complete Sequence

704 bp (704 high quality bases) assembled on 2005-03-04

GenBank Submission: BT023169

> IP03353.complete
CTTATGCTGAGAAGTAAACAAAAGGCGACGAATGTTTGTATTTTCCTAAT
AAAAGCCAATGGAGGATTGGAAATCGGAGGAAATGGCAAGGAAAAGAAAC
AGGAATAGGAGCAAGCAGCGCAGACGAAGGCAGAAAAGTGAGGGAAAGCC
GAAGCCACATACATCTCGAGATCAGTGGAGCAATGTGGCTCAAATATACC
AAAGCCTTTTTGAATGGCACCACAATCATGTTATGAGTCTCTGCCCTGAG
GTTAATCCGAATCTGGATCAGGACCTTGAGGATATTCCCAAGGAAACAGG
AACGTTTCACTGCCTGGACTACGTGTACGAGAGTTCTTCCGAGGATGAGG
AGATCGAACCCATTGACGAAGGCTATCTGAAGTTCCTCGAGGTGACCATT
AAGCATCAGCAGGAACTCAGGGATCGAAGAACTGCCCAAACCACCGACTC
TTTAGATTAGAATTTTGGTAAAATAGGTTTTTACGCAGATGAAAACTTAC
AGTTCATTTTTATCTGGTAATGACTTAAAAATGTATCTTACGTAAAATGT
TATAATTTAAGCTCAAGTTTATAAGTTTGGTATTTAGTTTTGGTAAGCAG
AAAATGTACGTTTTATAGGTGATATTTTTATATGTAGCACTTTGTCTTGA
ACGTATTAAGTATATAAGATGTTTTGATAACTTAAAAAAAAAAAAAAAAA
AAAA

IP03353.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:53:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG13689-RA 1009 CG13689-RA 72..756 1..685 3365 99.4 Plus
CG13689.b 1681 CG13689.b 72..756 1..685 3365 99.4 Plus
CG13689.a 626 CG13689.a 135..626 192..683 2400 99.1 Plus
CG13689.a 626 CG13689.a 1..137 1..137 685 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:15:13
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 603070..603558 195..683 2370 99 Plus
chr2L 23010047 chr2L 602809..603002 1..194 940 99 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:37:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:15:11
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 603074..603564 195..685 2395 99.2 Plus
2L 23513712 2L 602813..603006 1..194 970 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:41:41
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 603074..603564 195..685 2395 99.1 Plus
2L 23513712 2L 602813..603006 1..194 970 100 Plus
Blast to na_te.dros performed on 2019-03-15 20:15:11 has no hits.

IP03353.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:16:18 Download gff for IP03353.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 602809..603002 1..194 98 -> Plus
chr2L 603070..603558 195..683 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:20:19 Download gff for IP03353.complete
Subject Subject Range Query Range Percent Splice Strand
CG13689-RA 1..402 59..460 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:24:28 Download gff for IP03353.complete
Subject Subject Range Query Range Percent Splice Strand
CG13689-RA 1..402 59..460 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:05:03 Download gff for IP03353.complete
Subject Subject Range Query Range Percent Splice Strand
CG13689-RA 1..402 59..460 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:09:17 Download gff for IP03353.complete
Subject Subject Range Query Range Percent Splice Strand
CG13689-RA 1..402 59..460 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:32:05 Download gff for IP03353.complete
Subject Subject Range Query Range Percent Splice Strand
CG13689-RA 1..402 59..460 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:27:25 Download gff for IP03353.complete
Subject Subject Range Query Range Percent Splice Strand
CG13689-RA 1..683 1..683 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:24:28 Download gff for IP03353.complete
Subject Subject Range Query Range Percent Splice Strand
CG13689-RA 1..683 1..683 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:05:03 Download gff for IP03353.complete
Subject Subject Range Query Range Percent Splice Strand
CG13689-RA 1..683 1..683 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:09:17 Download gff for IP03353.complete
Subject Subject Range Query Range Percent Splice Strand
CG13689-RA 1..683 1..683 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:32:05 Download gff for IP03353.complete
Subject Subject Range Query Range Percent Splice Strand
CG13689-RA 1..683 1..683 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:16:18 Download gff for IP03353.complete
Subject Subject Range Query Range Percent Splice Strand
2L 602813..603006 1..194 100 -> Plus
2L 603074..603562 195..683 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:16:18 Download gff for IP03353.complete
Subject Subject Range Query Range Percent Splice Strand
2L 602813..603006 1..194 100 -> Plus
2L 603074..603562 195..683 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:16:18 Download gff for IP03353.complete
Subject Subject Range Query Range Percent Splice Strand
2L 602813..603006 1..194 100 -> Plus
2L 603074..603562 195..683 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:05:03 Download gff for IP03353.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 602813..603006 1..194 100 -> Plus
arm_2L 603074..603562 195..683 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:44:57 Download gff for IP03353.complete
Subject Subject Range Query Range Percent Splice Strand
2L 603074..603562 195..683 99   Plus
2L 602813..603006 1..194 100 -> Plus

IP03353.hyp Sequence

Translation from 58 to 459

> IP03353.hyp
MEDWKSEEMARKRNRNRSKQRRRRQKSEGKPKPHTSRDQWSNVAQIYQSL
FEWHHNHVMSLCPEVNPNLDQDLEDIPKETGTFHCLDYVYESSSEDEEIE
PIDEGYLKFLEVTIKHQQELRDRRTAQTTDSLD*

IP03353.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:01:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG13689-PA 133 CG13689-PA 1..133 1..133 719 100 Plus
CG13689-PB 114 CG13689-PB 1..114 1..133 583 85.7 Plus

IP03353.pep Sequence

Translation from 58 to 459

> IP03353.pep
MEDWKSEEMARKRNRNRSKQRRRRQKSEGKPKPHTSRDQWSNVAQIYQSL
FEWHHNHVMSLCPEVNPNLDQDLEDIPKETGTFHCLDYVYESSSEDEEIE
PIDEGYLKFLEVTIKHQQELRDRRTAQTTDSLD*

IP03353.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:11:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15027-PA 146 GF15027-PA 42..135 29..124 176 50.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:11:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24733-PA 133 GG24733-PA 1..133 1..133 478 91 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG13689-PA 133 CG13689-PA 1..133 1..133 719 100 Plus
CG13689-PB 114 CG13689-PB 1..114 1..133 583 85.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:11:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16756-PA 133 GM16756-PA 1..133 1..133 542 94.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:11:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23037-PA 133 GD23037-PA 1..133 1..133 545 95.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:11:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24420-PA 135 GK24420-PA 20..121 26..131 138 40.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:11:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16968-PA 133 GE16968-PA 1..133 1..133 519 89.5 Plus