IP03390.complete Sequence
434 bp assembled on 2009-06-08
GenBank Submission: BT088775.1
> IP03390.complete
AGCACTATAGCCATGCGATACCTGCCCTTTATCGCATTTTTCCTGTTTGC
TCTTCTGGCCCTGTCTGTGGGCGAGGAATTTTGCAATTGTAATCTTATCT
ATAGACCATTGTGCGCATCGAACTCCAAGACCTATAACAACTACTGTGAA
TTCAAGTGTGAAGTTAAAAGGGGAAGCCCCATAACAGTGGTAAAATGGAA
ACAGTGCAATGAAAGTGCGGGGAAAATAAAGATAGATTGCCAATTGCCTA
TAAACTTACAGTTGTGTAAAAGTATAAAATCTAATCGAAAAGATCCAATC
GCTATAGCTTAAACTATGTTTACACAAACGGCATTGTTGAAATCTTCTTC
GCAGTATATATTTCCAATAGGTTCATGACAATGCAAATAAATATAAAATT
TAAATACAAAAAAACAAAAAAAAAAAAAAAAAAA
IP03390.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 21:31:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp33A3-RA | 421 | Sfp33A3-RA | 12..419 | 1..408 | 2040 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:23:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 11838599..11839006 | 1..408 | 2025 | 99.8 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:37:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:23:27
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 11839923..11840330 | 1..408 | 2040 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:47:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 11839923..11840330 | 1..408 | 2040 | 100 | Plus |
Blast to na_te.dros performed 2019-03-16 14:23:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\Tom | 7060 | Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). | 779..815 | 378..414 | 131 | 83.8 | Plus |
412 | 7567 | 412 412 7567bp | 1150..1229 | 335..414 | 120 | 67.5 | Plus |
accord | 7404 | accord ACCORD 7404bp | 1376..1412 | 109..73 | 113 | 78.4 | Minus |
412 | 7567 | 412 412 7567bp | 1346..1499 | 256..413 | 103 | 56 | Plus |
IP03390.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:24:05 Download gff for
IP03390.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 11838599..11838980 | 1..382 | 99 | -> | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:10:03 Download gff for
IP03390.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A3-RA | 1..300 | 13..312 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:47:00 Download gff for
IP03390.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A3-RA | 1..300 | 13..312 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:35:27 Download gff for
IP03390.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A3-RA | 1..300 | 13..312 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:31:34 Download gff for
IP03390.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A3-RA | 1..300 | 13..312 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-06-08 11:40:47 Download gff for
IP03390.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A3-RA | 12..421 | 1..410 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:47:00 Download gff for
IP03390.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A3-RA | 12..421 | 1..410 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:35:27 Download gff for
IP03390.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A3-RA | 12..418 | 1..407 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:31:34 Download gff for
IP03390.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A3-RA | 12..418 | 1..407 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:24:05 Download gff for
IP03390.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 11839923..11840337 | 1..415 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:24:05 Download gff for
IP03390.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 11839923..11840337 | 1..415 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:24:05 Download gff for
IP03390.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 11839923..11840337 | 1..415 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:35:27 Download gff for
IP03390.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 11839923..11840337 | 1..415 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:22:24 Download gff for
IP03390.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 11839923..11840337 | 1..415 | 99 | | Plus |
IP03390.hyp Sequence
Translation from 0 to 311
> IP03390.hyp
STIAMRYLPFIAFFLFALLALSVGEEFCNCNLIYRPLCASNSKTYNNYCE
FKCEVKRGSPITVVKWKQCNESAGKIKIDCQLPINLQLCKSIKSNRKDPI
AIA*
IP03390.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:02:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp33A3-PA | 99 | CG42474-PA | 1..99 | 5..103 | 533 | 100 | Plus |
CG31704-PB | 68 | CG31704-PB | 1..68 | 5..69 | 153 | 50 | Plus |
CG31704-PA | 68 | CG31704-PA | 1..68 | 5..69 | 153 | 50 | Plus |
IP03390.pep Sequence
Translation from 0 to 311
> IP03390.pep
STIAMRYLPFIAFFLFALLALSVGEEFCNCNLIYRPLCASNSKTYNNYCE
FKCEVKRGSPITVVKWKQCNESAGKIKIDCQLPINLQLCKSIKSNRKDPI
AIA*
IP03390.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:45:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG23738-PA | 67 | GG23738-PA | 1..67 | 5..69 | 143 | 47.1 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp33A3-PA | 99 | CG42474-PA | 1..99 | 5..103 | 533 | 100 | Plus |
CG31704-PB | 68 | CG31704-PB | 1..68 | 5..69 | 153 | 50 | Plus |
CG31704-PA | 68 | CG31704-PA | 1..68 | 5..69 | 153 | 50 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:45:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL15365-PA | 71 | GL15365-PA | 1..71 | 5..69 | 143 | 40.8 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:45:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA16408-PA | 71 | GA16408-PA | 1..71 | 5..69 | 143 | 40.8 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:45:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM26602-PA | 68 | GM26602-PA | 1..68 | 5..69 | 133 | 48.5 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:45:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD23791-PA | 68 | GD23791-PA | 1..68 | 5..69 | 140 | 51.5 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:45:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE18544-PA | 69 | GE18544-PA | 1..69 | 5..69 | 159 | 50.7 | Plus |