Clone IP03390 Report

Search the DGRC for IP03390

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:33
Well:90
Vector:pOT2
Associated Gene/TranscriptSfp33A3-RA
Protein status:IP03390.pep: gold
Preliminary Size:1539
Sequenced Size:434

Clone Sequence Records

IP03390.complete Sequence

434 bp assembled on 2009-06-08

GenBank Submission: BT088775.1

> IP03390.complete
AGCACTATAGCCATGCGATACCTGCCCTTTATCGCATTTTTCCTGTTTGC
TCTTCTGGCCCTGTCTGTGGGCGAGGAATTTTGCAATTGTAATCTTATCT
ATAGACCATTGTGCGCATCGAACTCCAAGACCTATAACAACTACTGTGAA
TTCAAGTGTGAAGTTAAAAGGGGAAGCCCCATAACAGTGGTAAAATGGAA
ACAGTGCAATGAAAGTGCGGGGAAAATAAAGATAGATTGCCAATTGCCTA
TAAACTTACAGTTGTGTAAAAGTATAAAATCTAATCGAAAAGATCCAATC
GCTATAGCTTAAACTATGTTTACACAAACGGCATTGTTGAAATCTTCTTC
GCAGTATATATTTCCAATAGGTTCATGACAATGCAAATAAATATAAAATT
TAAATACAAAAAAACAAAAAAAAAAAAAAAAAAA

IP03390.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:31:24
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp33A3-RA 421 Sfp33A3-RA 12..419 1..408 2040 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 14:23:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 11838599..11839006 1..408 2025 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:37:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 14:23:27
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11839923..11840330 1..408 2040 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:47:49
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11839923..11840330 1..408 2040 100 Plus
Blast to na_te.dros performed 2019-03-16 14:23:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\Tom 7060 Dana\Tom DNTOMRETA 7060bp Derived from Z24451 (Rel. 44, Last updated, Version 6). 779..815 378..414 131 83.8 Plus
412 7567 412 412 7567bp 1150..1229 335..414 120 67.5 Plus
accord 7404 accord ACCORD 7404bp 1376..1412 109..73 113 78.4 Minus
412 7567 412 412 7567bp 1346..1499 256..413 103 56 Plus

IP03390.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 14:24:05 Download gff for IP03390.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 11838599..11838980 1..382 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2009-10-19 18:10:03 Download gff for IP03390.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A3-RA 1..300 13..312 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:47:00 Download gff for IP03390.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A3-RA 1..300 13..312 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:35:27 Download gff for IP03390.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A3-RA 1..300 13..312 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:31:34 Download gff for IP03390.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A3-RA 1..300 13..312 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2009-06-08 11:40:47 Download gff for IP03390.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A3-RA 12..421 1..410 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:47:00 Download gff for IP03390.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A3-RA 12..421 1..410 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:35:27 Download gff for IP03390.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A3-RA 12..418 1..407 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:31:34 Download gff for IP03390.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A3-RA 12..418 1..407 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:24:05 Download gff for IP03390.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11839923..11840337 1..415 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:24:05 Download gff for IP03390.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11839923..11840337 1..415 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 14:24:05 Download gff for IP03390.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11839923..11840337 1..415 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:35:27 Download gff for IP03390.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11839923..11840337 1..415 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:22:24 Download gff for IP03390.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11839923..11840337 1..415 99   Plus

IP03390.hyp Sequence

Translation from 0 to 311

> IP03390.hyp
STIAMRYLPFIAFFLFALLALSVGEEFCNCNLIYRPLCASNSKTYNNYCE
FKCEVKRGSPITVVKWKQCNESAGKIKIDCQLPINLQLCKSIKSNRKDPI
AIA*

IP03390.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:02:21
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp33A3-PA 99 CG42474-PA 1..99 5..103 533 100 Plus
CG31704-PB 68 CG31704-PB 1..68 5..69 153 50 Plus
CG31704-PA 68 CG31704-PA 1..68 5..69 153 50 Plus

IP03390.pep Sequence

Translation from 0 to 311

> IP03390.pep
STIAMRYLPFIAFFLFALLALSVGEEFCNCNLIYRPLCASNSKTYNNYCE
FKCEVKRGSPITVVKWKQCNESAGKIKIDCQLPINLQLCKSIKSNRKDPI
AIA*

IP03390.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 13:45:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23738-PA 67 GG23738-PA 1..67 5..69 143 47.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:52
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp33A3-PA 99 CG42474-PA 1..99 5..103 533 100 Plus
CG31704-PB 68 CG31704-PB 1..68 5..69 153 50 Plus
CG31704-PA 68 CG31704-PA 1..68 5..69 153 50 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 13:45:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15365-PA 71 GL15365-PA 1..71 5..69 143 40.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 13:45:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16408-PA 71 GA16408-PA 1..71 5..69 143 40.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 13:45:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26602-PA 68 GM26602-PA 1..68 5..69 133 48.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 13:45:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23791-PA 68 GD23791-PA 1..68 5..69 140 51.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 13:45:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18544-PA 69 GE18544-PA 1..69 5..69 159 50.7 Plus