Clone IP03422 Report

Search the DGRC for IP03422

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:34
Well:22
Vector:pOT2
Associated Gene/TranscriptCG11666-RA
Protein status:IP03422.pep: gold
Preliminary Size:291
Sequenced Size:580

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11666 2005-01-01 Successful iPCR screen
CG11666 2008-04-29 Release 5.5 accounting
CG11666 2008-08-15 Release 5.9 accounting
CG11666 2008-12-18 5.12 accounting

Clone Sequence Records

IP03422.complete Sequence

580 bp (580 high quality bases) assembled on 2004-12-17

GenBank Submission: BT023700

> IP03422.complete
AAAAATTCAAATAAAACTAAAATCGTTCGAACACAATGGATGTCAAGCAA
CAGTTGCAGGCGCAGGATGTGGATAAGGATCTCGACGAGGTAACCACGAG
CAGCGAGGAGCAGTACAACCATGACCTGACCAAAAACTCCAGTTTGACGA
CCGTGTGCAGCACTTTTCCATTGTCCTCGAGGATCGAAAGCTACCATCAC
TGGCAGCCGATAGACATCGACATTGGGCGAGAGGACATCTTGGAACGTAA
ATTGGAAATGGAGAGTGAGCGAATGGTCCAGCCCGCCATGTCCATTCCAC
TCGCCCTAAATGCCATGCATCCTTAATGCCAAATTAAATAAAATAATGTC
AAATTAGAATTCAATTTCAAAGTTTACAAAAAGTTATGGCTCTCATGCGT
CGTATGAGTAACGCGCAGAAGAATACGCATACGACCCATTGTACCACCAT
GCCCTTTAACTTACAATGCATTGATGTGCTTAATAAAAGCAAGATAGTTA
ATTGTGCCTTGATAAATACTCGATTTGAAGAGATTAAAGTCCGTTCGACT
TTCGAAACCAGAAAAAAAAAAAAAAAAAAA

IP03422.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:50:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG11666-RA 564 CG11666-RA 1..564 1..564 2820 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:49:38
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 20849882..20850442 1..561 2745 99.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:37:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:49:37
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20984686..20985256 1..571 2825 99.6 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:38:15
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 20969778..20970348 1..571 2825 99.6 Plus
Blast to na_te.dros performed 2019-03-16 03:49:37
Subject Length Description Subject Range Query Range Score Percent Strand
jockey2 3428 jockey2 JOCKEY2 3428bp 3382..3421 332..371 110 75 Plus
transib1 2167 transib1 TRANSIB1 2167bp 1871..1918 375..331 107 72.9 Minus

IP03422.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:50:28 Download gff for IP03422.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 20849882..20850442 1..561 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:20:25 Download gff for IP03422.complete
Subject Subject Range Query Range Percent Splice Strand
CG11666-RA 1..291 36..326 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:19:06 Download gff for IP03422.complete
Subject Subject Range Query Range Percent Splice Strand
CG11666-RA 1..291 36..326 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:05:05 Download gff for IP03422.complete
Subject Subject Range Query Range Percent Splice Strand
CG11666-RA 1..291 36..326 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:05:38 Download gff for IP03422.complete
Subject Subject Range Query Range Percent Splice Strand
CG11666-RA 1..291 36..326 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:16:10 Download gff for IP03422.complete
Subject Subject Range Query Range Percent Splice Strand
CG11666-RA 1..291 36..326 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:22:36 Download gff for IP03422.complete
Subject Subject Range Query Range Percent Splice Strand
CG11666-RA 1..561 1..561 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:19:06 Download gff for IP03422.complete
Subject Subject Range Query Range Percent Splice Strand
CG11666-RA 1..561 1..561 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:05:05 Download gff for IP03422.complete
Subject Subject Range Query Range Percent Splice Strand
CG11666-RA 1..561 1..561 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:05:38 Download gff for IP03422.complete
Subject Subject Range Query Range Percent Splice Strand
CG11666-RA 1..561 1..561 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:16:10 Download gff for IP03422.complete
Subject Subject Range Query Range Percent Splice Strand
CG11666-RA 1..561 1..561 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:50:28 Download gff for IP03422.complete
Subject Subject Range Query Range Percent Splice Strand
X 20984686..20985246 1..561 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:50:28 Download gff for IP03422.complete
Subject Subject Range Query Range Percent Splice Strand
X 20984686..20985246 1..561 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:50:28 Download gff for IP03422.complete
Subject Subject Range Query Range Percent Splice Strand
X 20984686..20985246 1..561 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:05:05 Download gff for IP03422.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20855713..20856273 1..561 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:39:18 Download gff for IP03422.complete
Subject Subject Range Query Range Percent Splice Strand
X 20969778..20970338 1..561 100   Plus

IP03422.hyp Sequence

Translation from 35 to 325

> IP03422.hyp
MDVKQQLQAQDVDKDLDEVTTSSEEQYNHDLTKNSSLTTVCSTFPLSSRI
ESYHHWQPIDIDIGREDILERKLEMESERMVQPAMSIPLALNAMHP*

IP03422.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:02:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG11666-PA 96 CG11666-PA 1..96 1..96 496 100 Plus

IP03422.pep Sequence

Translation from 35 to 325

> IP03422.pep
MDVKQQLQAQDVDKDLDEVTTSSEEQYNHDLTKNSSLTTVCSTFPLSSRI
ESYHHWQPIDIDIGREDILERKLEMESERMVQPAMSIPLALNAMHP*

IP03422.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:49:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19702-PA 100 GG19702-PA 1..100 1..96 366 71 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:32:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG11666-PA 96 CG11666-PA 1..96 1..96 496 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:49:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23056-PA 96 GM23056-PA 1..96 1..96 414 83.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:49:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17506-PA 96 GD17506-PA 1..96 1..96 411 82.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:49:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17901-PA 91 GE17901-PA 1..91 1..96 320 66 Plus