IP03422.complete Sequence
580 bp (580 high quality bases) assembled on 2004-12-17
GenBank Submission: BT023700
> IP03422.complete
AAAAATTCAAATAAAACTAAAATCGTTCGAACACAATGGATGTCAAGCAA
CAGTTGCAGGCGCAGGATGTGGATAAGGATCTCGACGAGGTAACCACGAG
CAGCGAGGAGCAGTACAACCATGACCTGACCAAAAACTCCAGTTTGACGA
CCGTGTGCAGCACTTTTCCATTGTCCTCGAGGATCGAAAGCTACCATCAC
TGGCAGCCGATAGACATCGACATTGGGCGAGAGGACATCTTGGAACGTAA
ATTGGAAATGGAGAGTGAGCGAATGGTCCAGCCCGCCATGTCCATTCCAC
TCGCCCTAAATGCCATGCATCCTTAATGCCAAATTAAATAAAATAATGTC
AAATTAGAATTCAATTTCAAAGTTTACAAAAAGTTATGGCTCTCATGCGT
CGTATGAGTAACGCGCAGAAGAATACGCATACGACCCATTGTACCACCAT
GCCCTTTAACTTACAATGCATTGATGTGCTTAATAAAAGCAAGATAGTTA
ATTGTGCCTTGATAAATACTCGATTTGAAGAGATTAAAGTCCGTTCGACT
TTCGAAACCAGAAAAAAAAAAAAAAAAAAA
IP03422.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:50:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11666-RA | 564 | CG11666-RA | 1..564 | 1..564 | 2820 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:49:38
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chrX | 22417052 | chrX | 20849882..20850442 | 1..561 | 2745 | 99.3 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:37:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:49:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 20984686..20985256 | 1..571 | 2825 | 99.6 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:38:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23527363 | X | 20969778..20970348 | 1..571 | 2825 | 99.6 | Plus |
Blast to na_te.dros performed 2019-03-16 03:49:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
jockey2 | 3428 | jockey2 JOCKEY2 3428bp | 3382..3421 | 332..371 | 110 | 75 | Plus |
transib1 | 2167 | transib1 TRANSIB1 2167bp | 1871..1918 | 375..331 | 107 | 72.9 | Minus |
IP03422.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:50:28 Download gff for
IP03422.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chrX | 20849882..20850442 | 1..561 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:20:25 Download gff for
IP03422.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11666-RA | 1..291 | 36..326 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:19:06 Download gff for
IP03422.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11666-RA | 1..291 | 36..326 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:05:05 Download gff for
IP03422.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11666-RA | 1..291 | 36..326 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:05:38 Download gff for
IP03422.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11666-RA | 1..291 | 36..326 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:16:10 Download gff for
IP03422.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11666-RA | 1..291 | 36..326 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:22:36 Download gff for
IP03422.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11666-RA | 1..561 | 1..561 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:19:06 Download gff for
IP03422.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11666-RA | 1..561 | 1..561 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:05:05 Download gff for
IP03422.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11666-RA | 1..561 | 1..561 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:05:38 Download gff for
IP03422.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11666-RA | 1..561 | 1..561 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:16:10 Download gff for
IP03422.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG11666-RA | 1..561 | 1..561 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:50:28 Download gff for
IP03422.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 20984686..20985246 | 1..561 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:50:28 Download gff for
IP03422.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 20984686..20985246 | 1..561 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:50:28 Download gff for
IP03422.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 20984686..20985246 | 1..561 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:05:05 Download gff for
IP03422.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 20855713..20856273 | 1..561 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:39:18 Download gff for
IP03422.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 20969778..20970338 | 1..561 | 100 | | Plus |
IP03422.hyp Sequence
Translation from 35 to 325
> IP03422.hyp
MDVKQQLQAQDVDKDLDEVTTSSEEQYNHDLTKNSSLTTVCSTFPLSSRI
ESYHHWQPIDIDIGREDILERKLEMESERMVQPAMSIPLALNAMHP*
IP03422.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:02:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11666-PA | 96 | CG11666-PA | 1..96 | 1..96 | 496 | 100 | Plus |
IP03422.pep Sequence
Translation from 35 to 325
> IP03422.pep
MDVKQQLQAQDVDKDLDEVTTSSEEQYNHDLTKNSSLTTVCSTFPLSSRI
ESYHHWQPIDIDIGREDILERKLEMESERMVQPAMSIPLALNAMHP*
IP03422.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:49:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG19702-PA | 100 | GG19702-PA | 1..100 | 1..96 | 366 | 71 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:32:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG11666-PA | 96 | CG11666-PA | 1..96 | 1..96 | 496 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:49:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM23056-PA | 96 | GM23056-PA | 1..96 | 1..96 | 414 | 83.3 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:49:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD17506-PA | 96 | GD17506-PA | 1..96 | 1..96 | 411 | 82.3 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:49:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE17901-PA | 91 | GE17901-PA | 1..91 | 1..96 | 320 | 66 | Plus |