BDGP Sequence Production Resources |
Search the DGRC for IP03424
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 34 |
Well: | 24 |
Vector: | pOT2 |
Associated Gene/Transcript | CG11985-RA |
Protein status: | IP03424.pep: gold |
Preliminary Size: | 258 |
Sequenced Size: | 327 |
Gene | Date | Evidence |
---|---|---|
CG11985 | 2005-01-01 | Successful iPCR screen |
CG11985 | 2008-04-29 | Release 5.5 accounting |
CG11985 | 2008-08-15 | Release 5.9 accounting |
CG11985 | 2008-12-18 | 5.12 accounting |
327 bp (327 high quality bases) assembled on 2004-12-17
GenBank Submission: BT023697
> IP03424.complete AAACAACTTAAGCAAAATGGGTGAACGCTACAATATCCACAGCCAGCTGG AGCATCTACAAAGCAAGTACATCGGAACAGGACACGCGGATACCACAAAG TTCGAGTGGCTAACAAATCAACATCGCGACTCCTTGGCCAGCTACATGGG TCACTACGATATTCTCAACTACTTTGCCATAGCGGAAAATGAATCGAAGG CACGAGTGCGATTTAATCTGATGGAGCGAATGCTGCAGCCATGTGGGCCA CCACCAGAAAAGCTAGAGGATTAAGAAAAACTATTTTAATAATAAAGAAA ATAATTGACAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG11985-RA | 312 | CG11985-RA | 4..312 | 1..309 | 1545 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 4840866..4841174 | 309..1 | 1530 | 99.7 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 9014970..9015280 | 311..1 | 1555 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 8755801..8756111 | 311..1 | 1555 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 4840866..4841174 | 1..309 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11985-RA | 1..258 | 17..274 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11985-RA | 1..258 | 17..274 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11985-RA | 1..258 | 17..274 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11985-RA | 1..258 | 17..274 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11985-RA | 1..258 | 17..274 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11985-RA | 1..258 | 17..274 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11985-RA | 4..312 | 1..309 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11985-RA | 62..370 | 1..309 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11985-RA | 1..258 | 17..274 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11985-RA | 62..370 | 1..309 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 9014972..9015280 | 1..309 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 9014972..9015280 | 1..309 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 9014972..9015280 | 1..309 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 4840694..4841002 | 1..309 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 8755803..8756111 | 1..309 | 100 | Minus |
Translation from 0 to 273
> IP03424.hyp NNLSKMGERYNIHSQLEHLQSKYIGTGHADTTKFEWLTNQHRDSLASYMG HYDILNYFAIAENESKARVRFNLMERMLQPCGPPPEKLED*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG11985-PA | 85 | CG11985-PA | 1..85 | 6..90 | 462 | 100 | Plus |
Translation from 16 to 273
> IP03424.pep MGERYNIHSQLEHLQSKYIGTGHADTTKFEWLTNQHRDSLASYMGHYDIL NYFAIAENESKARVRFNLMERMLQPCGPPPEKLED*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF18434-PA | 85 | GF18434-PA | 1..85 | 1..85 | 458 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG17400-PA | 85 | GG17400-PA | 1..85 | 1..85 | 463 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18222-PA | 85 | GH18222-PA | 1..85 | 1..85 | 461 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Sf3b5-PA | 85 | CG11985-PA | 1..85 | 1..85 | 462 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10176-PA | 85 | GI10176-PA | 1..85 | 1..85 | 461 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL15204-PA | 85 | GL15204-PA | 1..85 | 1..85 | 460 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA25581-PA | 85 | GA25581-PA | 1..85 | 1..85 | 460 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM26290-PA | 85 | GM26290-PA | 1..85 | 1..85 | 463 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD20826-PA | 85 | GD20826-PA | 1..85 | 1..85 | 463 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ10878-PA | 85 | GJ10878-PA | 1..85 | 1..85 | 461 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK11422-PA | 85 | GK11422-PA | 1..85 | 1..85 | 460 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE24804-PA | 85 | GE24804-PA | 1..85 | 1..85 | 463 | 100 | Plus |