Clone IP03424 Report

Search the DGRC for IP03424

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:34
Well:24
Vector:pOT2
Associated Gene/TranscriptCG11985-RA
Protein status:IP03424.pep: gold
Preliminary Size:258
Sequenced Size:327

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11985 2005-01-01 Successful iPCR screen
CG11985 2008-04-29 Release 5.5 accounting
CG11985 2008-08-15 Release 5.9 accounting
CG11985 2008-12-18 5.12 accounting

Clone Sequence Records

IP03424.complete Sequence

327 bp (327 high quality bases) assembled on 2004-12-17

GenBank Submission: BT023697

> IP03424.complete
AAACAACTTAAGCAAAATGGGTGAACGCTACAATATCCACAGCCAGCTGG
AGCATCTACAAAGCAAGTACATCGGAACAGGACACGCGGATACCACAAAG
TTCGAGTGGCTAACAAATCAACATCGCGACTCCTTGGCCAGCTACATGGG
TCACTACGATATTCTCAACTACTTTGCCATAGCGGAAAATGAATCGAAGG
CACGAGTGCGATTTAATCTGATGGAGCGAATGCTGCAGCCATGTGGGCCA
CCACCAGAAAAGCTAGAGGATTAAGAAAAACTATTTTAATAATAAAGAAA
ATAATTGACAAAAAAAAAAAAAAAAAA

IP03424.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:50:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG11985-RA 312 CG11985-RA 4..312 1..309 1545 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 23:58:11
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 4840866..4841174 309..1 1530 99.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:37:57 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 23:58:09
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9014970..9015280 311..1 1555 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:38:33
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 8755801..8756111 311..1 1555 100 Minus
Blast to na_te.dros performed on 2019-03-16 23:58:10 has no hits.

IP03424.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 23:59:11 Download gff for IP03424.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 4840866..4841174 1..309 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:20:26 Download gff for IP03424.complete
Subject Subject Range Query Range Percent Splice Strand
CG11985-RA 1..258 17..274 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:19:35 Download gff for IP03424.complete
Subject Subject Range Query Range Percent Splice Strand
CG11985-RA 1..258 17..274 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:54:56 Download gff for IP03424.complete
Subject Subject Range Query Range Percent Splice Strand
CG11985-RA 1..258 17..274 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:05:39 Download gff for IP03424.complete
Subject Subject Range Query Range Percent Splice Strand
CG11985-RA 1..258 17..274 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:05:50 Download gff for IP03424.complete
Subject Subject Range Query Range Percent Splice Strand
CG11985-RA 1..258 17..274 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:22:38 Download gff for IP03424.complete
Subject Subject Range Query Range Percent Splice Strand
CG11985-RA 1..258 17..274 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:19:35 Download gff for IP03424.complete
Subject Subject Range Query Range Percent Splice Strand
CG11985-RA 4..312 1..309 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:54:56 Download gff for IP03424.complete
Subject Subject Range Query Range Percent Splice Strand
CG11985-RA 62..370 1..309 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:05:39 Download gff for IP03424.complete
Subject Subject Range Query Range Percent Splice Strand
CG11985-RA 1..258 17..274 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:05:50 Download gff for IP03424.complete
Subject Subject Range Query Range Percent Splice Strand
CG11985-RA 62..370 1..309 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:59:11 Download gff for IP03424.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9014972..9015280 1..309 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:59:11 Download gff for IP03424.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9014972..9015280 1..309 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 23:59:11 Download gff for IP03424.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9014972..9015280 1..309 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:54:56 Download gff for IP03424.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4840694..4841002 1..309 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:39:48 Download gff for IP03424.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8755803..8756111 1..309 100   Minus

IP03424.hyp Sequence

Translation from 0 to 273

> IP03424.hyp
NNLSKMGERYNIHSQLEHLQSKYIGTGHADTTKFEWLTNQHRDSLASYMG
HYDILNYFAIAENESKARVRFNLMERMLQPCGPPPEKLED*

IP03424.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:02:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG11985-PA 85 CG11985-PA 1..85 6..90 462 100 Plus

IP03424.pep Sequence

Translation from 16 to 273

> IP03424.pep
MGERYNIHSQLEHLQSKYIGTGHADTTKFEWLTNQHRDSLASYMGHYDIL
NYFAIAENESKARVRFNLMERMLQPCGPPPEKLED*

IP03424.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:48:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18434-PA 85 GF18434-PA 1..85 1..85 458 98.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:48:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17400-PA 85 GG17400-PA 1..85 1..85 463 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:48:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18222-PA 85 GH18222-PA 1..85 1..85 461 98.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:06:15
Subject Length Description Subject Range Query Range Score Percent Strand
Sf3b5-PA 85 CG11985-PA 1..85 1..85 462 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:48:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10176-PA 85 GI10176-PA 1..85 1..85 461 98.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:48:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15204-PA 85 GL15204-PA 1..85 1..85 460 98.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:48:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25581-PA 85 GA25581-PA 1..85 1..85 460 98.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:48:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26290-PA 85 GM26290-PA 1..85 1..85 463 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:48:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20826-PA 85 GD20826-PA 1..85 1..85 463 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:48:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10878-PA 85 GJ10878-PA 1..85 1..85 461 98.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:48:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11422-PA 85 GK11422-PA 1..85 1..85 460 98.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:48:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24804-PA 85 GE24804-PA 1..85 1..85 463 100 Plus