IP03442.complete Sequence
416 bp (416 high quality bases) assembled on 2005-03-04
GenBank Submission: BT023156.1
> IP03442.complete
TGAACTGAAGCAAGAAGATGTCACAGAGAATGTACTTATCCTTTGCTCTC
TTACTTTGCCTTTTGGCACTTGGAAATGCCGATCTGCAATTGTATCATCC
CCTGATGACCCTGCACCACCCACCAACTTTTGCCAAGGTGGGCCATCTGG
TGGAGCATGTGCCCACCGCAGTTTCGCACCAGAGTTCCACCATCGTTCAT
CGCAGTGTTCCGAGGACTACATCACTGTTGACACCCGCTTTGAGGTCCAC
CTATCTGAACTATCCCACCTGGGGTTATCCACTTTTCGATGGCACCAACA
CGCTGTACAGAAAGTAGGCATCTGCATTGGAAACGATTCGAATAATTGGG
CTACCGAACTTTGGGTTTGAACAATAAAACAAAAGCCCCAATCCCCTAAA
AAAAAAAAAAAAAAAA
IP03442.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:53:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13056-RA | 563 | CG13056-RA | 38..438 | 1..401 | 2005 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:17:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 16323148..16323513 | 32..397 | 1830 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:38:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:17:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 16333417..16333786 | 32..401 | 1850 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:42:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 16326517..16326886 | 32..401 | 1850 | 100 | Plus |
3L | 28103327 | 3L | 16326418..16326449 | 1..32 | 160 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 10:17:12 has no hits.
IP03442.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:17:56 Download gff for
IP03442.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 16323049..16323080 | 1..32 | 100 | -> | Plus |
chr3L | 16323149..16323513 | 33..397 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:20:30 Download gff for
IP03442.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13056-RA | 1..300 | 18..317 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:25:08 Download gff for
IP03442.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13056-RA | 1..300 | 18..317 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:59:32 Download gff for
IP03442.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13056-RA | 1..300 | 18..317 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:09:21 Download gff for
IP03442.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13056-RA | 1..300 | 18..317 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:03:40 Download gff for
IP03442.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13056-RA | 1..300 | 18..317 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:27:32 Download gff for
IP03442.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13056-RA | 1..397 | 1..397 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:25:08 Download gff for
IP03442.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13056-RA | 6..402 | 1..397 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:59:32 Download gff for
IP03442.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13056-RA | 6..402 | 1..397 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:09:21 Download gff for
IP03442.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13056-RA | 1..397 | 1..397 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:03:40 Download gff for
IP03442.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13056-RA | 6..402 | 1..397 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:17:56 Download gff for
IP03442.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 16333318..16333349 | 1..32 | 100 | -> | Plus |
3L | 16333418..16333782 | 33..397 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:17:56 Download gff for
IP03442.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 16333318..16333349 | 1..32 | 100 | -> | Plus |
3L | 16333418..16333782 | 33..397 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:17:56 Download gff for
IP03442.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 16333318..16333349 | 1..32 | 100 | -> | Plus |
3L | 16333418..16333782 | 33..397 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:59:32 Download gff for
IP03442.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 16326418..16326449 | 1..32 | 100 | -> | Plus |
arm_3L | 16326518..16326882 | 33..397 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:45:39 Download gff for
IP03442.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 16326518..16326882 | 33..397 | 100 | | Plus |
3L | 16326418..16326449 | 1..32 | 100 | -> | Plus |
IP03442.hyp Sequence
Translation from 0 to 369
> IP03442.hyp
ELKQEDVTENVLILCSLTLPFGTWKCRSAIVSSPDDPAPPTNFCQGGPSG
GACAHRSFAPEFHHRSSQCSEDYITVDTRFEVHLSELSHLGLSTFRWHQH
AVQKVGICIGNDSNNWATELWV*
Sequence IP03442.hyp has no blast hits.
IP03442.pep Sequence
Translation from 17 to 316
> IP03442.pep
MSQRMYLSFALLLCLLALGNADLQLYHPLMTLHHPPTFAKVGHLVEHVPT
AVSHQSSTIVHRSVPRTTSLLTPALRSTYLNYPTWGYPLFDGTNTLYRK*
IP03442.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:07:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF24188-PA | 98 | GF24188-PA | 1..98 | 1..99 | 311 | 60 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:07:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG15992-PA | 99 | GG15992-PA | 1..99 | 1..99 | 374 | 85.9 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13056-PA | 99 | CG13056-PA | 1..99 | 1..99 | 527 | 100 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:07:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA12008-PA | 100 | GA12008-PA | 1..100 | 1..99 | 298 | 61 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:07:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM25624-PA | 99 | GM25624-PA | 1..99 | 1..99 | 443 | 96 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:07:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD14628-PA | 99 | GD14628-PA | 1..99 | 1..99 | 443 | 96 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:07:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ12785-PA | 179 | GJ12785-PA | 111..157 | 34..80 | 134 | 59.6 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:07:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE23103-PA | 99 | GE23103-PA | 1..99 | 1..99 | 458 | 88.9 | Plus |
Dyak\GE19557-PA | 99 | GE19557-PA | 1..99 | 1..99 | 455 | 87.9 | Plus |