Clone IP03442 Report

Search the DGRC for IP03442

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:34
Well:42
Vector:pOT2
Associated Gene/TranscriptCG13056-RA
Protein status:IP03442.pep: gold
Preliminary Size:213
Sequenced Size:416

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13056 2005-01-01 Successful iPCR screen
CG13056 2008-04-29 Release 5.5 accounting
CG13056 2008-08-15 Release 5.9 accounting
CG13056 2008-12-18 5.12 accounting

Clone Sequence Records

IP03442.complete Sequence

416 bp (416 high quality bases) assembled on 2005-03-04

GenBank Submission: BT023156.1

> IP03442.complete
TGAACTGAAGCAAGAAGATGTCACAGAGAATGTACTTATCCTTTGCTCTC
TTACTTTGCCTTTTGGCACTTGGAAATGCCGATCTGCAATTGTATCATCC
CCTGATGACCCTGCACCACCCACCAACTTTTGCCAAGGTGGGCCATCTGG
TGGAGCATGTGCCCACCGCAGTTTCGCACCAGAGTTCCACCATCGTTCAT
CGCAGTGTTCCGAGGACTACATCACTGTTGACACCCGCTTTGAGGTCCAC
CTATCTGAACTATCCCACCTGGGGTTATCCACTTTTCGATGGCACCAACA
CGCTGTACAGAAAGTAGGCATCTGCATTGGAAACGATTCGAATAATTGGG
CTACCGAACTTTGGGTTTGAACAATAAAACAAAAGCCCCAATCCCCTAAA
AAAAAAAAAAAAAAAA

IP03442.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:53:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG13056-RA 563 CG13056-RA 38..438 1..401 2005 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 10:17:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 16323148..16323513 32..397 1830 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:38:02 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 10:17:12
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16333417..16333786 32..401 1850 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:42:07
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 16326517..16326886 32..401 1850 100 Plus
3L 28103327 3L 16326418..16326449 1..32 160 100 Plus
Blast to na_te.dros performed on 2019-03-16 10:17:12 has no hits.

IP03442.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 10:17:56 Download gff for IP03442.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 16323049..16323080 1..32 100 -> Plus
chr3L 16323149..16323513 33..397 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:20:30 Download gff for IP03442.complete
Subject Subject Range Query Range Percent Splice Strand
CG13056-RA 1..300 18..317 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:25:08 Download gff for IP03442.complete
Subject Subject Range Query Range Percent Splice Strand
CG13056-RA 1..300 18..317 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:59:32 Download gff for IP03442.complete
Subject Subject Range Query Range Percent Splice Strand
CG13056-RA 1..300 18..317 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:09:21 Download gff for IP03442.complete
Subject Subject Range Query Range Percent Splice Strand
CG13056-RA 1..300 18..317 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:03:40 Download gff for IP03442.complete
Subject Subject Range Query Range Percent Splice Strand
CG13056-RA 1..300 18..317 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:27:32 Download gff for IP03442.complete
Subject Subject Range Query Range Percent Splice Strand
CG13056-RA 1..397 1..397 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:25:08 Download gff for IP03442.complete
Subject Subject Range Query Range Percent Splice Strand
CG13056-RA 6..402 1..397 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:59:32 Download gff for IP03442.complete
Subject Subject Range Query Range Percent Splice Strand
CG13056-RA 6..402 1..397 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:09:21 Download gff for IP03442.complete
Subject Subject Range Query Range Percent Splice Strand
CG13056-RA 1..397 1..397 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:03:40 Download gff for IP03442.complete
Subject Subject Range Query Range Percent Splice Strand
CG13056-RA 6..402 1..397 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:17:56 Download gff for IP03442.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16333318..16333349 1..32 100 -> Plus
3L 16333418..16333782 33..397 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:17:56 Download gff for IP03442.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16333318..16333349 1..32 100 -> Plus
3L 16333418..16333782 33..397 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 10:17:56 Download gff for IP03442.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16333318..16333349 1..32 100 -> Plus
3L 16333418..16333782 33..397 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:59:32 Download gff for IP03442.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16326418..16326449 1..32 100 -> Plus
arm_3L 16326518..16326882 33..397 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:45:39 Download gff for IP03442.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16326518..16326882 33..397 100   Plus
3L 16326418..16326449 1..32 100 -> Plus

IP03442.hyp Sequence

Translation from 0 to 369

> IP03442.hyp
ELKQEDVTENVLILCSLTLPFGTWKCRSAIVSSPDDPAPPTNFCQGGPSG
GACAHRSFAPEFHHRSSQCSEDYITVDTRFEVHLSELSHLGLSTFRWHQH
AVQKVGICIGNDSNNWATELWV*
Sequence IP03442.hyp has no blast hits.

IP03442.pep Sequence

Translation from 17 to 316

> IP03442.pep
MSQRMYLSFALLLCLLALGNADLQLYHPLMTLHHPPTFAKVGHLVEHVPT
AVSHQSSTIVHRSVPRTTSLLTPALRSTYLNYPTWGYPLFDGTNTLYRK*

IP03442.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:07:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24188-PA 98 GF24188-PA 1..98 1..99 311 60 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:07:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15992-PA 99 GG15992-PA 1..99 1..99 374 85.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:52:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG13056-PA 99 CG13056-PA 1..99 1..99 527 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:07:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12008-PA 100 GA12008-PA 1..100 1..99 298 61 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:07:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25624-PA 99 GM25624-PA 1..99 1..99 443 96 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:07:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14628-PA 99 GD14628-PA 1..99 1..99 443 96 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:07:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12785-PA 179 GJ12785-PA 111..157 34..80 134 59.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:07:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23103-PA 99 GE23103-PA 1..99 1..99 458 88.9 Plus
Dyak\GE19557-PA 99 GE19557-PA 1..99 1..99 455 87.9 Plus