BDGP Sequence Production Resources |
Search the DGRC for IP03474
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 34 |
Well: | 74 |
Vector: | pOT2 |
Associated Gene/Transcript | CG14483-RA |
Protein status: | IP03474.pep: gold |
Preliminary Size: | 249 |
Sequenced Size: | 472 |
Gene | Date | Evidence |
---|---|---|
CG14483 | 2005-01-01 | Successful iPCR screen |
CG14483 | 2008-04-29 | Release 5.5 accounting |
CG14483 | 2008-08-15 | Release 5.9 accounting |
CG14483 | 2008-12-18 | 5.12 accounting |
472 bp (472 high quality bases) assembled on 2004-12-17
GenBank Submission: BT023698
> IP03474.complete ATTCGACGAAAATTACGTTTTATCACAACTATCCGAGTAATATTACAGCG AAATGGGAACCTGGGTGCTGGAGGTGGCCAAGATGGGCATGTACATGGCC TTTCCGGTGACGCTATTCCACTTGTTTAACCAGCCGGAATACTTTGAAGA ATGGGTGACCAAGAAGAAGCGGGAACTTTATCCGCCGGAAAGCAAAAGCC ACCACGAGGAGCTGCAGCGGGCAATCCGTGAACACCACGCCCAGCACGAC GCCAAAATGATGCGTGCTATGGAGGAGGCGGAGGGCAAGCAGAAGAAGTA GATATTTCGTTATCAACAATCATCCGGCTAATCCCACGTTATATAATCGG GGGCAAGCAAACAACCGATGCTCCGGATGGATGTGACTAACTGATCTGTA ACGACGTAATAAAAACATATTGTATTTAACCGAACAACACTCGGTTAATC ATCAGGAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14483-RA | 520 | CG14483-RA | 65..520 | 1..456 | 2280 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 13472710..13473155 | 446..1 | 2230 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 17585632..17586090 | 459..1 | 2295 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 17586831..17587289 | 459..1 | 2295 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 13472701..13473155 | 1..456 | 98 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14483-RA | 1..249 | 53..301 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14483-RA | 1..249 | 53..301 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14483-RA | 1..249 | 53..301 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14483-RA | 1..249 | 53..301 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14483-RA | 1..249 | 53..301 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14483-RA | 1..456 | 1..456 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14483-RA | 65..520 | 1..456 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14483-RA | 60..515 | 1..456 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14483-RA | 1..456 | 1..456 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14483-RA | 60..515 | 1..456 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 17585635..17586090 | 1..456 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 17585635..17586090 | 1..456 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 17585635..17586090 | 1..456 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 13473140..13473595 | 1..456 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 17586834..17587289 | 1..456 | 100 | Minus |
Translation from 52 to 300
> IP03474.pep MGTWVLEVAKMGMYMAFPVTLFHLFNQPEYFEEWVTKKKRELYPPESKSH HEELQRAIREHHAQHDAKMMRAMEEAEGKQKK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11587-PA | 80 | GF11587-PA | 1..80 | 1..80 | 393 | 91.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21039-PA | 82 | GG21039-PA | 1..82 | 1..82 | 425 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21816-PA | 80 | GH21816-PA | 1..77 | 1..77 | 375 | 90.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14483-PC | 82 | CG14483-PC | 1..82 | 1..82 | 444 | 100 | Plus |
CG14483-PB | 82 | CG14483-PB | 1..82 | 1..82 | 444 | 100 | Plus |
CG14483-PA | 82 | CG14483-PA | 1..82 | 1..82 | 444 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20787-PA | 80 | GI20787-PA | 1..80 | 1..80 | 368 | 83.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17688-PA | 80 | GL17688-PA | 1..80 | 1..80 | 377 | 90 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13019-PA | 80 | GA13019-PA | 1..80 | 1..80 | 377 | 90 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM19967-PA | 82 | GM19967-PA | 1..82 | 1..82 | 429 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD25461-PA | 82 | GD25461-PA | 1..82 | 1..82 | 429 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20521-PA | 80 | GJ20521-PA | 1..80 | 1..80 | 385 | 90 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK10668-PA | 80 | GK10668-PA | 1..80 | 1..80 | 394 | 93.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13982-PA | 82 | GE13982-PA | 1..82 | 1..82 | 426 | 98.8 | Plus |
Translation from 52 to 300
> IP03474.hyp MGTWVLEVAKMGMYMAFPVTLFHLFNQPEYFEEWVTKKKRELYPPESKSH HEELQRAIREHHAQHDAKMMRAMEEAEGKQKK*