Clone IP03474 Report

Search the DGRC for IP03474

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:34
Well:74
Vector:pOT2
Associated Gene/TranscriptCG14483-RA
Protein status:IP03474.pep: gold
Preliminary Size:249
Sequenced Size:472

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14483 2005-01-01 Successful iPCR screen
CG14483 2008-04-29 Release 5.5 accounting
CG14483 2008-08-15 Release 5.9 accounting
CG14483 2008-12-18 5.12 accounting

Clone Sequence Records

IP03474.complete Sequence

472 bp (472 high quality bases) assembled on 2004-12-17

GenBank Submission: BT023698

> IP03474.complete
ATTCGACGAAAATTACGTTTTATCACAACTATCCGAGTAATATTACAGCG
AAATGGGAACCTGGGTGCTGGAGGTGGCCAAGATGGGCATGTACATGGCC
TTTCCGGTGACGCTATTCCACTTGTTTAACCAGCCGGAATACTTTGAAGA
ATGGGTGACCAAGAAGAAGCGGGAACTTTATCCGCCGGAAAGCAAAAGCC
ACCACGAGGAGCTGCAGCGGGCAATCCGTGAACACCACGCCCAGCACGAC
GCCAAAATGATGCGTGCTATGGAGGAGGCGGAGGGCAAGCAGAAGAAGTA
GATATTTCGTTATCAACAATCATCCGGCTAATCCCACGTTATATAATCGG
GGGCAAGCAAACAACCGATGCTCCGGATGGATGTGACTAACTGATCTGTA
ACGACGTAATAAAAACATATTGTATTTAACCGAACAACACTCGGTTAATC
ATCAGGAAAAAAAAAAAAAAAA

IP03474.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:50:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG14483-RA 520 CG14483-RA 65..520 1..456 2280 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:45:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13472710..13473155 446..1 2230 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:38:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:45:30
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17585632..17586090 459..1 2295 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:39:22
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17586831..17587289 459..1 2295 100 Minus
Blast to na_te.dros performed on 2019-03-15 15:45:31 has no hits.

IP03474.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:46:37 Download gff for IP03474.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13472701..13473155 1..456 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:20:33 Download gff for IP03474.complete
Subject Subject Range Query Range Percent Splice Strand
CG14483-RA 1..249 53..301 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:20:53 Download gff for IP03474.complete
Subject Subject Range Query Range Percent Splice Strand
CG14483-RA 1..249 53..301 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:39:01 Download gff for IP03474.complete
Subject Subject Range Query Range Percent Splice Strand
CG14483-RA 1..249 53..301 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:05:40 Download gff for IP03474.complete
Subject Subject Range Query Range Percent Splice Strand
CG14483-RA 1..249 53..301 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:14:48 Download gff for IP03474.complete
Subject Subject Range Query Range Percent Splice Strand
CG14483-RA 1..249 53..301 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:22:39 Download gff for IP03474.complete
Subject Subject Range Query Range Percent Splice Strand
CG14483-RA 1..456 1..456 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:20:53 Download gff for IP03474.complete
Subject Subject Range Query Range Percent Splice Strand
CG14483-RA 65..520 1..456 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:39:01 Download gff for IP03474.complete
Subject Subject Range Query Range Percent Splice Strand
CG14483-RA 60..515 1..456 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:05:40 Download gff for IP03474.complete
Subject Subject Range Query Range Percent Splice Strand
CG14483-RA 1..456 1..456 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:14:48 Download gff for IP03474.complete
Subject Subject Range Query Range Percent Splice Strand
CG14483-RA 60..515 1..456 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:46:37 Download gff for IP03474.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17585635..17586090 1..456 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:46:37 Download gff for IP03474.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17585635..17586090 1..456 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:46:37 Download gff for IP03474.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17585635..17586090 1..456 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:39:01 Download gff for IP03474.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13473140..13473595 1..456 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:41:09 Download gff for IP03474.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17586834..17587289 1..456 100   Minus

IP03474.pep Sequence

Translation from 52 to 300

> IP03474.pep
MGTWVLEVAKMGMYMAFPVTLFHLFNQPEYFEEWVTKKKRELYPPESKSH
HEELQRAIREHHAQHDAKMMRAMEEAEGKQKK*

IP03474.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:49:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11587-PA 80 GF11587-PA 1..80 1..80 393 91.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:49:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21039-PA 82 GG21039-PA 1..82 1..82 425 98.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:49:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21816-PA 80 GH21816-PA 1..77 1..77 375 90.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG14483-PC 82 CG14483-PC 1..82 1..82 444 100 Plus
CG14483-PB 82 CG14483-PB 1..82 1..82 444 100 Plus
CG14483-PA 82 CG14483-PA 1..82 1..82 444 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:49:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20787-PA 80 GI20787-PA 1..80 1..80 368 83.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:49:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17688-PA 80 GL17688-PA 1..80 1..80 377 90 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:49:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13019-PA 80 GA13019-PA 1..80 1..80 377 90 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:49:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19967-PA 82 GM19967-PA 1..82 1..82 429 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:49:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25461-PA 82 GD25461-PA 1..82 1..82 429 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:49:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20521-PA 80 GJ20521-PA 1..80 1..80 385 90 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:49:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10668-PA 80 GK10668-PA 1..80 1..80 394 93.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:49:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13982-PA 82 GE13982-PA 1..82 1..82 426 98.8 Plus

IP03474.hyp Sequence

Translation from 52 to 300

> IP03474.hyp
MGTWVLEVAKMGMYMAFPVTLFHLFNQPEYFEEWVTKKKRELYPPESKSH
HEELQRAIREHHAQHDAKMMRAMEEAEGKQKK*

IP03474.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:02:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG14483-PC 82 CG14483-PC 1..82 1..82 444 100 Plus
CG14483-PB 82 CG14483-PB 1..82 1..82 444 100 Plus
CG14483-PA 82 CG14483-PA 1..82 1..82 444 100 Plus