Clone IP03529 Report

Search the DGRC for IP03529

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:35
Well:29
Vector:pOT2
Associated Gene/TranscriptBest3-RA
Protein status:IP03529.pep: gold
Preliminary Size:1608
Sequenced Size:1728

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12327 2005-01-01 Successful iPCR screen
Best3 2008-04-29 Release 5.5 accounting
Best3 2008-08-15 Release 5.9 accounting
Best3 2008-12-18 5.12 accounting

Clone Sequence Records

IP03529.complete Sequence

1728 bp (1728 high quality bases) assembled on 2005-04-11

GenBank Submission: BT023144

> IP03529.complete
AGCCGTTCGGTATTATTAAAGTTTTCCAATTGACAATTCTCGAGTATGAC
TGTCTCTTACACCGCTGAGGTGGCAACATGCAGCCATTTCGGCTGCTTCT
GGAAGCTTTTGATGAGATGGCGCGCAAGTATCTACAAGATAATATGGGTG
GATCTTCTGGCATTCCTGTCCTGCTTCTACTTCATGGCTGTAATATATCG
CTATGCTCTCAGGGACGTCGATAAGCCTGTTTTCGAGGACATTGTGATGT
ACTGTCATAGCTATAGCAACCTGATTCCGCTCTCTTTCGTACTGGGATTT
TATGTGGGCATTATCATAGAACGCTGGTGGAATCAATATATCACAGTTCC
TTGGCCCGATCCGCTGGCGGTTTATGTGAGTGCCTTGGTCCGTGGCCAAG
ATGAACATGGTCGTCTGATGAGACGCACGATTATGAGATATGTGTGCTTG
GCATTGACTATGGTGCTCTCGATGATATCGCCAGTTATAAAGCGTCGCTT
TCCAACCTACGATCAGTTAATTGAGGTGGGTTTGCTAAACGCCAACGAGG
CAAATATTATGAAGGCAATGGATGTGAAGTTTCCAAAGCACCCAAAGTAT
TGGATGCCCATTGTCTGGGCCGCCAGTATTGTAACAAGGGCTCGAAAGGA
AGGTCGAATTTGGGATGACTTCTCCCTGAAGTCCATGATAGATGAGCTCA
ATAAATTCCGAGCTGGATGCAATATGCTCATCCATTACGATACAATCTCA
GTGCCACTGGTCTATACACAGGTCGTCACCCTGGCCGTCTACTCGTACTT
TGTGGCCTCGATATTTGGTCACCAGTGGATCGATCGGGATATTAAGCACT
ACAATAATATTGTTAGTTACTACTTTCCGTTGTTCAGCACTCTGGAGTTT
TTCTTCTTCATGGGCTGGCTTAAGGTGGCCGAGACATTGATTTGTCCTTT
TGGCGATGACGACGATGACTTTGAACTGAACTGGCTGATCGATCGCAACT
TGCAAGTGAGTTACTTGATCGTTGATGAAATGCACAATGATCATCCGCAG
TTGGTGAGGGATCAGTATTGGGATGAGGTGTTTCCCGCTGAGTTGCCATA
TGCCGTGGAGTCCGATAGGGCCGAACATCCGGAGGCATCAACCGCTCGAT
TGGGCATACCAAAAGTTGTCCCCGTGACCATGACGAAAAGCGAAGTCAGT
TTGGAAAACGATTTTACAGAGTTCGACGATGAGGATGAATACAACCCGGA
AGTAACTATACGATTTGCCCGCCGGGAGTTCAGTTGGAGCAAAAGTTCAG
TATCGGTATCGTACTCCTATGACAACCAGAGTATTGATACCCTTGACGAG
AAGGTTGATGAAGAGAACGAGGGAGATACAAGGACTCTAGATTCCAGAAA
CAAGGACGACTTTGACCGTCTAAAGGAGAAGCGGGACAGGGAGCGTGTGA
ACCGGCAGATGCAACAAGCCGCCCTCGCCATGGAGTTGATTAAAGGGGAT
CTGGCTTCGAATGGAGGATCAGCTCGATCAAGTCGTACTAATGTCCCGCA
AAAAAATTCTGATGTCCAGACCGACAGAAGCTACTTAAGTCAGAAAAAGA
GAAAGGAGGAGGACACGGACAATGATAAGGACAGTGACGAATCTAAGAAA
TAACGAATGAATCCTTAAAATGTACAGAAACAAATTGTGATTTTAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP03529.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:39:01
Subject Length Description Subject Range Query Range Score Percent Strand
Best3-RA 1764 Best3-RA 71..1764 1..1694 8470 100 Plus
Best1-RA 3144 Best1-RA 1313..1507 892..1086 330 77.9 Plus
Best1-RB 3288 Best1-RB 1313..1507 892..1086 330 77.9 Plus
Best1-RA 3144 Best1-RA 1013..1116 601..704 220 80.7 Plus
Best1-RB 3288 Best1-RB 1013..1116 601..704 220 80.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:02:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 15290967..15291892 1694..769 4615 99.9 Minus
chr3L 24539361 chr3L 15291939..15292484 773..228 2730 100 Minus
chr3L 24539361 chr3L 15292722..15292837 116..1 580 100 Minus
chr3L 24539361 chr3L 15292552..15292664 227..115 565 100 Minus
chr3R 27901430 chr3R 5991050..5991153 704..601 220 80.8 Minus
chr3R 27901430 chr3R 5990771..5990853 974..892 190 81.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:38:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:02:01
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15300913..15301840 1696..769 4640 100 Minus
3L 28110227 3L 15301887..15302432 773..228 2730 100 Minus
3L 28110227 3L 15302670..15302785 116..1 580 100 Minus
3L 28110227 3L 15302500..15302612 227..115 565 100 Minus
3R 32079331 3R 10165299..10165402 704..601 220 80.8 Minus
3R 32079331 3R 10165020..10165102 974..892 190 81.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:29:16
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 15294013..15294940 1696..769 4640 100 Minus
3L 28103327 3L 15294987..15295532 773..228 2730 100 Minus
3L 28103327 3L 15295770..15295885 116..1 580 100 Minus
3L 28103327 3L 15295600..15295712 227..115 565 100 Minus
3R 31820162 3R 9906130..9906233 704..601 220 80.7 Minus
3R 31820162 3R 9905851..9905933 974..892 190 81.9 Minus
Blast to na_te.dros performed on 2019-03-15 18:02:01 has no hits.

IP03529.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:02:44 Download gff for IP03529.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 15290967..15291889 772..1694 99 <- Minus
chr3L 15291941..15292484 228..771 100 <- Minus
chr3L 15292552..15292662 117..227 100 <- Minus
chr3L 15292722..15292837 1..116 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:20:44 Download gff for IP03529.complete
Subject Subject Range Query Range Percent Splice Strand
Best3-RA 1..1608 46..1653 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:05:09 Download gff for IP03529.complete
Subject Subject Range Query Range Percent Splice Strand
Best3-RA 1..1608 46..1653 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:53:14 Download gff for IP03529.complete
Subject Subject Range Query Range Percent Splice Strand
Best3-RA 1..1608 46..1653 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:50:15 Download gff for IP03529.complete
Subject Subject Range Query Range Percent Splice Strand
Best3-RA 1..1608 46..1653 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:53:10 Download gff for IP03529.complete
Subject Subject Range Query Range Percent Splice Strand
Best3-RA 1..1608 46..1653 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:52:55 Download gff for IP03529.complete
Subject Subject Range Query Range Percent Splice Strand
Best3-RA 1..1608 46..1653 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:05:09 Download gff for IP03529.complete
Subject Subject Range Query Range Percent Splice Strand
Best3-RA 1..1694 1..1694 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:53:14 Download gff for IP03529.complete
Subject Subject Range Query Range Percent Splice Strand
Best3-RA 1..1694 1..1694 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:50:15 Download gff for IP03529.complete
Subject Subject Range Query Range Percent Splice Strand
Best3-RA 1..1608 46..1653 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:53:10 Download gff for IP03529.complete
Subject Subject Range Query Range Percent Splice Strand
Best3-RA 1..1694 1..1694 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:02:44 Download gff for IP03529.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15300915..15301837 772..1694 100 <- Minus
3L 15301889..15302432 228..771 100 <- Minus
3L 15302500..15302610 117..227 100 <- Minus
3L 15302670..15302785 1..116 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:02:44 Download gff for IP03529.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15300915..15301837 772..1694 100 <- Minus
3L 15301889..15302432 228..771 100 <- Minus
3L 15302500..15302610 117..227 100 <- Minus
3L 15302670..15302785 1..116 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:02:44 Download gff for IP03529.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15300915..15301837 772..1694 100 <- Minus
3L 15301889..15302432 228..771 100 <- Minus
3L 15302500..15302610 117..227 100 <- Minus
3L 15302670..15302785 1..116 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:53:14 Download gff for IP03529.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15294015..15294937 772..1694 100 <- Minus
arm_3L 15294989..15295532 228..771 100 <- Minus
arm_3L 15295600..15295710 117..227 100 <- Minus
arm_3L 15295770..15295885 1..116 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:24:58 Download gff for IP03529.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15294015..15294937 772..1694 100 <- Minus
3L 15294989..15295532 228..771 100 <- Minus
3L 15295600..15295710 117..227 100 <- Minus
3L 15295770..15295885 1..116 100   Minus

IP03529.hyp Sequence

Translation from 45 to 1652

> IP03529.hyp
MTVSYTAEVATCSHFGCFWKLLMRWRASIYKIIWVDLLAFLSCFYFMAVI
YRYALRDVDKPVFEDIVMYCHSYSNLIPLSFVLGFYVGIIIERWWNQYIT
VPWPDPLAVYVSALVRGQDEHGRLMRRTIMRYVCLALTMVLSMISPVIKR
RFPTYDQLIEVGLLNANEANIMKAMDVKFPKHPKYWMPIVWAASIVTRAR
KEGRIWDDFSLKSMIDELNKFRAGCNMLIHYDTISVPLVYTQVVTLAVYS
YFVASIFGHQWIDRDIKHYNNIVSYYFPLFSTLEFFFFMGWLKVAETLIC
PFGDDDDDFELNWLIDRNLQVSYLIVDEMHNDHPQLVRDQYWDEVFPAEL
PYAVESDRAEHPEASTARLGIPKVVPVTMTKSEVSLENDFTEFDDEDEYN
PEVTIRFARREFSWSKSSVSVSYSYDNQSIDTLDEKVDEENEGDTRTLDS
RNKDDFDRLKEKRDRERVNRQMQQAALAMELIKGDLASNGGSARSSRTNV
PQKNSDVQTDRSYLSQKKRKEEDTDNDKDSDESKK*

IP03529.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:03:40
Subject Length Description Subject Range Query Range Score Percent Strand
Best3-PA 535 CG12327-PA 1..535 1..535 2837 100 Plus
Best1-PA 721 CG6264-PA 1..392 1..387 1389 64 Plus
Best1-PD 736 CG6264-PD 1..392 1..387 1389 64 Plus
Best1-PB 769 CG6264-PB 1..392 1..387 1389 64 Plus
Best1-PC 784 CG6264-PC 1..392 1..387 1389 64 Plus

IP03529.pep Sequence

Translation from 45 to 1652

> IP03529.pep
MTVSYTAEVATCSHFGCFWKLLMRWRASIYKIIWVDLLAFLSCFYFMAVI
YRYALRDVDKPVFEDIVMYCHSYSNLIPLSFVLGFYVGIIIERWWNQYIT
VPWPDPLAVYVSALVRGQDEHGRLMRRTIMRYVCLALTMVLSMISPVIKR
RFPTYDQLIEVGLLNANEANIMKAMDVKFPKHPKYWMPIVWAASIVTRAR
KEGRIWDDFSLKSMIDELNKFRAGCNMLIHYDTISVPLVYTQVVTLAVYS
YFVASIFGHQWIDRDIKHYNNIVSYYFPLFSTLEFFFFMGWLKVAETLIC
PFGDDDDDFELNWLIDRNLQVSYLIVDEMHNDHPQLVRDQYWDEVFPAEL
PYAVESDRAEHPEASTARLGIPKVVPVTMTKSEVSLENDFTEFDDEDEYN
PEVTIRFARREFSWSKSSVSVSYSYDNQSIDTLDEKVDEENEGDTRTLDS
RNKDDFDRLKEKRDRERVNRQMQQAALAMELIKGDLASNGGSARSSRTNV
PQKNSDVQTDRSYLSQKKRKEEDTDNDKDSDESKK*

IP03529.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 15:30:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10734-PA 526 GF10734-PA 1..509 1..516 2045 73.2 Plus
Dana\GF17535-PA 722 GF17535-PA 1..392 1..387 1454 64.5 Plus
Dana\GF23693-PA 540 GF23693-PA 18..369 18..369 1199 59.1 Plus
Dana\GF10904-PA 815 GF10904-PA 1..380 1..373 1022 48.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 15:30:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13553-PA 537 GG13553-PA 1..537 1..535 2499 90.7 Plus
Dere\GG17296-PA 769 GG17296-PA 1..392 1..387 1445 63.5 Plus
Dere\GG15891-PA 526 GG15891-PA 1..367 1..367 1180 56.9 Plus
Dere\GG14064-PA 809 GG14064-PA 1..380 1..373 1036 49 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 15:30:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17026-PA 535 GH17026-PA 1..535 1..518 1754 65.2 Plus
Dgri\Rfp1-PA 779 GH18459-PA 1..392 1..387 1468 64.3 Plus
Dgri\GH17028-PA 561 GH17028-PA 1..451 1..470 1279 51.2 Plus
Dgri\GH16281-PA 818 GH16281-PA 1..380 1..373 1040 49.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:22:21
Subject Length Description Subject Range Query Range Score Percent Strand
Best3-PA 535 CG12327-PA 1..535 1..535 2837 100 Plus
Best1-PD 736 CG6264-PD 1..392 1..387 1389 64 Plus
Best1-PC 784 CG6264-PC 1..392 1..387 1389 64 Plus
Best1-PB 769 CG6264-PB 1..392 1..387 1389 64 Plus
Best1-PA 721 CG6264-PA 1..392 1..387 1389 64 Plus
Best4-PB 526 CG7259-PB 1..462 1..470 1189 48.8 Plus
Best2-PA 809 CG10173-PA 1..380 1..373 1003 48.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 15:30:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12230-PA 541 GI12230-PA 1..541 1..522 1785 66.1 Plus
Dmoj\GI24037-PA 782 GI24037-PA 1..392 1..387 1456 63.5 Plus
Dmoj\GI12232-PA 510 GI12232-PA 1..442 1..470 1246 51.5 Plus
Dmoj\GI13224-PA 803 GI13224-PA 1..355 1..373 952 45.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 15:30:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25692-PA 514 GL25692-PA 1..494 1..491 1248 50 Plus
Dper\GL25671-PA 215 GL25671-PA 1..203 1..203 967 86.2 Plus
Dper\GL22521-PA 783 GL22521-PA 4..305 72..373 705 45.5 Plus
Dper\GL23840-PA 215 GL23840-PA 25..136 278..387 416 64.3 Plus
Dper\GL25682-PA 109 GL25682-PA 24..109 439..520 167 40.7 Plus
Dper\GL22521-PA 783 GL22521-PA 1..45 1..46 166 58.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 15:30:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11558-PA 522 GA11558-PA 1..522 1..520 2009 73 Plus
Dpse\GA19476-PA 765 GA19476-PA 1..392 1..387 1465 64.5 Plus
Dpse\GA19476-PB 721 GA19476-PB 1..392 1..387 1464 64.5 Plus
Dpse\GA20216-PA 514 GA20216-PA 1..494 1..491 1248 50 Plus
Dpse\GA24547-PA 841 GA24547-PA 1..380 1..373 1032 49.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 15:30:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24494-PA 533 GM24494-PA 1..533 1..535 2784 97.6 Plus
Dsec\GM26180-PA 767 GM26180-PA 1..392 1..387 1445 63.5 Plus
Dsec\GM25520-PA 526 GM25520-PA 1..367 1..367 1204 57.2 Plus
Dsec\GM13845-PA 809 GM13845-PA 1..380 1..373 1035 49 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 15:30:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12566-PA 533 GD12566-PA 1..533 1..535 2788 97.8 Plus
Dsim\GD14535-PA 526 GD14535-PA 1..367 1..367 1207 57.5 Plus
Dsim\GD13131-PA 809 GD13131-PA 1..380 1..373 1039 49.2 Plus
Dsim\GD20729-PA 417 GD20729-PA 1..83 302..380 291 61.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 15:30:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11462-PA 556 GJ11462-PA 1..556 1..520 1800 65.7 Plus
Dvir\GJ23667-PA 780 GJ23667-PA 1..392 1..387 1462 64 Plus
Dvir\GJ11464-PA 530 GJ11464-PA 1..370 1..369 1241 61.4 Plus
Dvir\GJ11999-PA 822 GJ11999-PA 1..372 1..365 1032 50.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 15:30:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20484-PA 564 GK20484-PA 1..511 1..509 1893 69.5 Plus
Dwil\GK22536-PA 744 GK22536-PA 1..392 1..387 1467 64.8 Plus
Dwil\GK20485-PA 464 GK20485-PA 1..463 1..446 1212 52.4 Plus
Dwil\GK13577-PA 838 GK13577-PA 1..378 1..373 1034 49.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 15:30:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19853-PA 535 GE19853-PA 1..522 1..521 2561 92.9 Plus
Dyak\GE24699-PA 769 GE24699-PA 1..392 1..387 1442 63.5 Plus
Dyak\GE22233-PA 526 GE22233-PA 1..369 1..369 1181 56.6 Plus
Dyak\GE20488-PA 809 GE20488-PA 1..380 1..373 1034 49 Plus