Clone IP03534 Report

Search the DGRC for IP03534

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:35
Well:34
Vector:pOT2
Associated Gene/TranscriptCG42339-RA
Protein status:IP03534.pep: gold
Preliminary Size:267
Sequenced Size:690

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12626 2005-01-01 Successful iPCR screen
CG12626 2008-04-29 Release 5.5 accounting
CG42339 2008-08-15 Release 5.9 accounting
CG42339 2008-12-18 5.12 accounting

Clone Sequence Records

IP03534.complete Sequence

690 bp (690 high quality bases) assembled on 2005-03-04

GenBank Submission: BT023145

> IP03534.complete
ACATTGTGTAACACAGCACAAACTCAAATTCAACAAATCAAATACGCAGG
GTTAAATCCGCACATAGACCGCATTTCGATCCGATTCGGTGAGACGATGT
CGTTGCTGCTGCTCCTTTTGGCCGTCATCCTGCCGCAGCGGCAGCTTCTG
CCCTTCGTATCCGGAGGGTCCTGCCGGGAGGCGCAGCTCTGCTGCAACGG
CCGCGACTCGTCCTGCGTCGTCCAGAAGGCTCCCATCAATGCCATCATCG
AGGATCTCAGCGACAAGCCCTGCTACTGTGACCACGCCTGCCTCAAGCTC
GGCGATTGCTGCGACGACTTCAAGGATCACTGTGGAGGAGTCTTTAGGCG
CCGAAAACTGAAGTCCATCCATCTGGCAGCCGGAAACTGCCATAAGCACG
GATCCGTTAAGAATGCAGCTGCAATGGCAATGATTTGATTTGTCCGTGGG
ATGGTGAGGTTCTTAGGATAACTTTGAGAAAGGATACCACCTCGACATCC
TTTCAAGAAACATGCGACTGACTCACACAAGTGCCAGAAGCAAAATAAGA
TGCATTCTCACGGATACACTGAGGGGATATTAACTTTGATATAACTTAAC
TTTGATATGATATATTATAATAATATATTAATAACAAGCCAATTAGCTAC
AAAGTGAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP03534.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:52:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG42339-RA 684 CG42339-RA 28..684 1..657 3285 100 Plus
CG42339-RB 2314 CG42339-RB 6..342 1..337 1685 100 Plus
CG42339.a 2360 CG42339.a 104..391 50..337 1440 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:03:27
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 10928749..10929086 338..1 1690 100 Minus
chrX 22417052 chrX 10927170..10927490 656..336 1590 99.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:38:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:03:25
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11037474..11037811 338..1 1690 100 Minus
X 23542271 X 11035889..11036210 657..336 1610 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:41:47
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11045572..11045909 338..1 1690 100 Minus
X 23527363 X 11043987..11044308 657..336 1610 100 Minus
Blast to na_te.dros performed 2019-03-16 18:03:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6797..6848 150..96 114 72.7 Minus

IP03534.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:04:28 Download gff for IP03534.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 10927170..10927488 338..656 91 <- Minus
chrX 10928750..10929086 1..337 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:20:45 Download gff for IP03534.complete
Subject Subject Range Query Range Percent Splice Strand
CG42339-RA 1..342 97..438 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:24:37 Download gff for IP03534.complete
Subject Subject Range Query Range Percent Splice Strand
CG42339-RA 1..342 97..438 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:08:15 Download gff for IP03534.complete
Subject Subject Range Query Range Percent Splice Strand
CG42339-RA 1..342 97..438 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:08:48 Download gff for IP03534.complete
Subject Subject Range Query Range Percent Splice Strand
CG42339-RA 1..342 97..438 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:28:36 Download gff for IP03534.complete
Subject Subject Range Query Range Percent Splice Strand
CG42339-RA 1..342 97..438 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:26:41 Download gff for IP03534.complete
Subject Subject Range Query Range Percent Splice Strand
CG42339-RA 1..656 1..656 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:24:37 Download gff for IP03534.complete
Subject Subject Range Query Range Percent Splice Strand
CG42339-RA 1..656 1..656 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:08:15 Download gff for IP03534.complete
Subject Subject Range Query Range Percent Splice Strand
CG42339-RA 1..656 1..656 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:08:48 Download gff for IP03534.complete
Subject Subject Range Query Range Percent Splice Strand
CG42339-RA 1..656 1..656 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:28:36 Download gff for IP03534.complete
Subject Subject Range Query Range Percent Splice Strand
CG42339-RA 1..656 1..656 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:04:28 Download gff for IP03534.complete
Subject Subject Range Query Range Percent Splice Strand
X 11035890..11036208 338..656 100 <- Minus
X 11037475..11037811 1..337 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:04:28 Download gff for IP03534.complete
Subject Subject Range Query Range Percent Splice Strand
X 11035890..11036208 338..656 100 <- Minus
X 11037475..11037811 1..337 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:04:28 Download gff for IP03534.complete
Subject Subject Range Query Range Percent Splice Strand
X 11035890..11036208 338..656 100 <- Minus
X 11037475..11037811 1..337 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:08:15 Download gff for IP03534.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10931508..10931844 1..337 100   Minus
arm_X 10929923..10930241 338..656 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:45:06 Download gff for IP03534.complete
Subject Subject Range Query Range Percent Splice Strand
X 11045573..11045909 1..337 100   Minus
X 11043988..11044306 338..656 100 <- Minus

IP03534.hyp Sequence

Translation from 0 to 437

> IP03534.hyp
TLCNTAQTQIQQIKYAGLNPHIDRISIRFGETMSLLLLLLAVILPQRQLL
PFVSGGSCREAQLCCNGRDSSCVVQKAPINAIIEDLSDKPCYCDHACLKL
GDCCDDFKDHCGGVFRRRKLKSIHLAAGNCHKHGSVKNAAAMAMI*

IP03534.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:03:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG42339-PA 113 CG12626-PA 1..113 33..145 611 100 Plus
CG42339-PB 395 CG15204-PA 1..80 33..112 441 100 Plus

IP03534.pep Sequence

Translation from 96 to 437

> IP03534.pep
MSLLLLLLAVILPQRQLLPFVSGGSCREAQLCCNGRDSSCVVQKAPINAI
IEDLSDKPCYCDHACLKLGDCCDDFKDHCGGVFRRRKLKSIHLAAGNCHK
HGSVKNAAAMAMI*

IP03534.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:07:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20401-PA 86 GF20401-PA 12..86 4..82 332 83.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:07:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18887-PA 84 GG18887-PA 1..81 1..81 407 97.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:07:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17598-PA 117 GH17598-PA 34..117 5..88 340 72.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:07:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG42339-PA 113 CG12626-PA 1..113 1..113 611 100 Plus
CG42339-PB 395 CG15204-PA 1..80 1..80 441 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:07:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16464-PA 111 GI16464-PA 19..93 7..81 336 84 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:07:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18318-PA 111 GL18318-PA 25..93 18..86 324 84.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:07:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11727-PA 108 GA11727-PA 26..87 19..80 314 91.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:07:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11272-PA 149 GM11272-PA 13..86 13..86 378 93.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:07:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16005-PA 93 GD16005-PA 1..89 1..85 410 92.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:07:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15943-PA 95 GJ15943-PA 24..88 16..80 323 92.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:07:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19898-PA 94 GK19898-PA 23..79 24..80 301 100 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:07:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17327-PA 85 GE17327-PA 1..82 1..82 408 95.1 Plus