IP03566.complete Sequence
458 bp (458 high quality bases) assembled on 2005-03-04
GenBank Submission: BT023141
> IP03566.complete
CGAGCGGTTTCGGTGTCAGTGCTACTCATCCTTGTTGTCTGGGTGTCCTG
TTTCGGCGAATCAGGCGCAGATTGCTGCTGGACAAAGGCCAAGCTGCTCT
TCACGATGGGCACAGGATCGTGCGGAATGGTCAATGCCAAGACCACCAAA
TACGGATGCGAGGCCACAGTTTGCGCGGATGGAAGAGTGCTCAAGGGCAC
ATATTGTGGCGTGGGTTCGTGCAATATCATTGGATGCTTTTGTCGCGGCG
GCTGTCTCACTGGAAACTATGGCGAGTCATTTGTGGAAATAAATAATAGG
TATCAGATCAACTTGATAAGCACCCAAATGAGGCTTGCCAATTTAACAGA
TACCGAGGCCTAATTTTAATTTTATTCCATTGAAATCAAAAAAAAAAAAA
CTTAACTTTGAGTAAAATAAAGCGTATCAAACAGATGTTAAAAAAAAAAA
AAAAAAAA
IP03566.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:52:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34329-RA | 505 | CG34329-RA | 4..443 | 1..440 | 2200 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:43:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chrX | 22417052 | chrX | 18939433..18939872 | 1..439 | 2150 | 99.8 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:38:23 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:43:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 19050476..19050915 | 1..440 | 2200 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:41:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23527363 | X | 19058574..19059013 | 1..440 | 2200 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-15 21:43:32 has no hits.
IP03566.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:44:46 Download gff for
IP03566.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chrX | 18939433..18939872 | 1..439 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:20:50 Download gff for
IP03566.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34329-RA | 4..366 | 1..363 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:24:54 Download gff for
IP03566.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34329-RA | 4..366 | 1..363 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:56:11 Download gff for
IP03566.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Diedel3-RA | 4..366 | 1..363 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:09:06 Download gff for
IP03566.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34329-RA | 4..366 | 1..363 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:01:07 Download gff for
IP03566.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Diedel3-RA | 4..366 | 1..363 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:27:10 Download gff for
IP03566.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34329-RA | 4..442 | 1..439 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:24:54 Download gff for
IP03566.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34329-RA | 4..442 | 1..439 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:56:11 Download gff for
IP03566.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Diedel3-RA | 4..442 | 1..439 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:09:06 Download gff for
IP03566.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34329-RA | 4..442 | 1..439 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:01:07 Download gff for
IP03566.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Diedel3-RA | 35..473 | 1..439 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:44:46 Download gff for
IP03566.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 19050476..19050914 | 1..439 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:44:46 Download gff for
IP03566.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 19050476..19050914 | 1..439 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:44:46 Download gff for
IP03566.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 19050476..19050914 | 1..439 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:56:11 Download gff for
IP03566.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 18944509..18944947 | 1..439 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:45:25 Download gff for
IP03566.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 19058574..19059012 | 1..439 | 100 | | Plus |
IP03566.pep Sequence
Translation from 0 to 362
> IP03566.pep
RAVSVSVLLILVVWVSCFGESGADCCWTKAKLLFTMGTGSCGMVNAKTTK
YGCEATVCADGRVLKGTYCGVGSCNIIGCFCRGGCLTGNYGESFVEINNR
YQINLISTQMRLANLTDTEA*
IP03566.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:09:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF15938-PA | 113 | GF15938-PA | 2..112 | 1..111 | 233 | 42.3 | Plus |
Dana\GF15937-PA | 113 | GF15937-PA | 2..112 | 1..111 | 231 | 40.5 | Plus |
Dana\GF16013-PA | 109 | GF16013-PA | 9..109 | 3..106 | 151 | 40.2 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:09:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG19205-PA | 121 | GG19205-PA | 2..121 | 1..120 | 510 | 79.2 | Plus |
Dere\GG11665-PA | 115 | GG11665-PA | 6..111 | 5..109 | 200 | 39.6 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:14:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Diedel3-PB | 121 | CG34329-PB | 2..121 | 1..120 | 650 | 100 | Plus |
Diedel3-PA | 121 | CG34329-PA | 2..121 | 1..120 | 650 | 100 | Plus |
Diedel2-PA | 125 | CG43228-PA | 4..105 | 8..109 | 226 | 37.3 | Plus |
Diedel-PA | 115 | CG11501-PA | 6..108 | 5..106 | 224 | 41.7 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:09:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI24242-PA | 113 | GI24242-PA | 6..111 | 6..109 | 180 | 39.8 | Plus |
Dmoj\GI11819-PA | 140 | GI11819-PA | 23..111 | 20..107 | 163 | 36 | Plus |
Dmoj\GI22343-PA | 117 | GI22343-PA | 47..115 | 40..107 | 136 | 39.1 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:09:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL13593-PA | 116 | GL13593-PA | 5..91 | 5..86 | 145 | 39.8 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:09:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA26837-PA | 116 | GA26837-PA | 5..91 | 5..86 | 145 | 39.8 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:09:35
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM12788-PA | 116 | GM12788-PA | 4..116 | 2..112 | 228 | 44.2 | Plus |
Dsec\GM12796-PA | 125 | GM12796-PA | 4..105 | 8..109 | 194 | 36.3 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:09:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD17420-PA | 121 | GD17420-PA | 2..121 | 1..120 | 592 | 95 | Plus |
Dsim\GD21438-PA | 116 | GD21438-PA | 4..116 | 2..112 | 216 | 42.5 | Plus |
Dsim\GD21443-PA | 125 | GD21443-PA | 4..105 | 8..109 | 197 | 36.3 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:09:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ11856-PA | 131 | GJ11856-PA | 18..102 | 23..106 | 165 | 37.6 | Plus |
Dvir\GJ11855-PA | 131 | GJ11855-PA | 18..102 | 23..106 | 165 | 37.6 | Plus |
Dvir\GJ14220-PA | 113 | GJ14220-PA | 25..111 | 23..107 | 131 | 32.2 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:09:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE17767-PA | 121 | GE17767-PA | 19..118 | 18..117 | 397 | 75 | Plus |
Dyak\GE23861-PA | 125 | GE23861-PA | 4..106 | 8..110 | 208 | 39.8 | Plus |
Dyak\GE23853-PA | 114 | GE23853-PA | 3..110 | 4..109 | 196 | 41.7 | Plus |
Dyak\GE23854-PA | 115 | GE23854-PA | 6..111 | 5..109 | 183 | 36.8 | Plus |
IP03566.hyp Sequence
Translation from 0 to 362
> IP03566.hyp
RAVSVSVLLILVVWVSCFGESGADCCWTKAKLLFTMGTGSCGMVNAKTTK
YGCEATVCADGRVLKGTYCGVGSCNIIGCFCRGGCLTGNYGESFVEINNR
YQINLISTQMRLANLTDTEA*
IP03566.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:03:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Diedel3-PB | 121 | CG34329-PB | 2..121 | 1..120 | 650 | 100 | Plus |
Diedel3-PA | 121 | CG34329-PA | 2..121 | 1..120 | 650 | 100 | Plus |
Diedel2-PA | 125 | CG43228-PA | 4..105 | 8..109 | 226 | 37.3 | Plus |
Diedel-PA | 115 | CG11501-PA | 6..108 | 5..106 | 224 | 41.7 | Plus |