Clone IP03566 Report

Search the DGRC for IP03566

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:35
Well:66
Vector:pOT2
Associated Gene/TranscriptCG34329-RA
Protein status:IP03566.pep:
Preliminary Size:246
Sequenced Size:458

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14189 2005-01-01 Successful iPCR screen
CG34329 2008-04-29 Release 5.5 accounting
CG34329 2008-08-15 Release 5.9 accounting
CG34329 2008-12-18 5.12 accounting

Clone Sequence Records

IP03566.complete Sequence

458 bp (458 high quality bases) assembled on 2005-03-04

GenBank Submission: BT023141

> IP03566.complete
CGAGCGGTTTCGGTGTCAGTGCTACTCATCCTTGTTGTCTGGGTGTCCTG
TTTCGGCGAATCAGGCGCAGATTGCTGCTGGACAAAGGCCAAGCTGCTCT
TCACGATGGGCACAGGATCGTGCGGAATGGTCAATGCCAAGACCACCAAA
TACGGATGCGAGGCCACAGTTTGCGCGGATGGAAGAGTGCTCAAGGGCAC
ATATTGTGGCGTGGGTTCGTGCAATATCATTGGATGCTTTTGTCGCGGCG
GCTGTCTCACTGGAAACTATGGCGAGTCATTTGTGGAAATAAATAATAGG
TATCAGATCAACTTGATAAGCACCCAAATGAGGCTTGCCAATTTAACAGA
TACCGAGGCCTAATTTTAATTTTATTCCATTGAAATCAAAAAAAAAAAAA
CTTAACTTTGAGTAAAATAAAGCGTATCAAACAGATGTTAAAAAAAAAAA
AAAAAAAA

IP03566.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:52:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG34329-RA 505 CG34329-RA 4..443 1..440 2200 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:43:34
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 18939433..18939872 1..439 2150 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:38:23 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:43:31
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19050476..19050915 1..440 2200 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:41:59
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 19058574..19059013 1..440 2200 100 Plus
Blast to na_te.dros performed on 2019-03-15 21:43:32 has no hits.

IP03566.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:44:46 Download gff for IP03566.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 18939433..18939872 1..439 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:20:50 Download gff for IP03566.complete
Subject Subject Range Query Range Percent Splice Strand
CG34329-RA 4..366 1..363 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:24:54 Download gff for IP03566.complete
Subject Subject Range Query Range Percent Splice Strand
CG34329-RA 4..366 1..363 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:56:11 Download gff for IP03566.complete
Subject Subject Range Query Range Percent Splice Strand
Diedel3-RA 4..366 1..363 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:09:06 Download gff for IP03566.complete
Subject Subject Range Query Range Percent Splice Strand
CG34329-RA 4..366 1..363 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:01:07 Download gff for IP03566.complete
Subject Subject Range Query Range Percent Splice Strand
Diedel3-RA 4..366 1..363 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:27:10 Download gff for IP03566.complete
Subject Subject Range Query Range Percent Splice Strand
CG34329-RA 4..442 1..439 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:24:54 Download gff for IP03566.complete
Subject Subject Range Query Range Percent Splice Strand
CG34329-RA 4..442 1..439 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:56:11 Download gff for IP03566.complete
Subject Subject Range Query Range Percent Splice Strand
Diedel3-RA 4..442 1..439 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:09:06 Download gff for IP03566.complete
Subject Subject Range Query Range Percent Splice Strand
CG34329-RA 4..442 1..439 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:01:07 Download gff for IP03566.complete
Subject Subject Range Query Range Percent Splice Strand
Diedel3-RA 35..473 1..439 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:44:46 Download gff for IP03566.complete
Subject Subject Range Query Range Percent Splice Strand
X 19050476..19050914 1..439 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:44:46 Download gff for IP03566.complete
Subject Subject Range Query Range Percent Splice Strand
X 19050476..19050914 1..439 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:44:46 Download gff for IP03566.complete
Subject Subject Range Query Range Percent Splice Strand
X 19050476..19050914 1..439 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:56:11 Download gff for IP03566.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 18944509..18944947 1..439 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:45:25 Download gff for IP03566.complete
Subject Subject Range Query Range Percent Splice Strand
X 19058574..19059012 1..439 100   Plus

IP03566.pep Sequence

Translation from 0 to 362

> IP03566.pep
RAVSVSVLLILVVWVSCFGESGADCCWTKAKLLFTMGTGSCGMVNAKTTK
YGCEATVCADGRVLKGTYCGVGSCNIIGCFCRGGCLTGNYGESFVEINNR
YQINLISTQMRLANLTDTEA*

IP03566.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:09:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15938-PA 113 GF15938-PA 2..112 1..111 233 42.3 Plus
Dana\GF15937-PA 113 GF15937-PA 2..112 1..111 231 40.5 Plus
Dana\GF16013-PA 109 GF16013-PA 9..109 3..106 151 40.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:09:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19205-PA 121 GG19205-PA 2..121 1..120 510 79.2 Plus
Dere\GG11665-PA 115 GG11665-PA 6..111 5..109 200 39.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:14:55
Subject Length Description Subject Range Query Range Score Percent Strand
Diedel3-PB 121 CG34329-PB 2..121 1..120 650 100 Plus
Diedel3-PA 121 CG34329-PA 2..121 1..120 650 100 Plus
Diedel2-PA 125 CG43228-PA 4..105 8..109 226 37.3 Plus
Diedel-PA 115 CG11501-PA 6..108 5..106 224 41.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:09:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24242-PA 113 GI24242-PA 6..111 6..109 180 39.8 Plus
Dmoj\GI11819-PA 140 GI11819-PA 23..111 20..107 163 36 Plus
Dmoj\GI22343-PA 117 GI22343-PA 47..115 40..107 136 39.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:09:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13593-PA 116 GL13593-PA 5..91 5..86 145 39.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:09:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26837-PA 116 GA26837-PA 5..91 5..86 145 39.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:09:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12788-PA 116 GM12788-PA 4..116 2..112 228 44.2 Plus
Dsec\GM12796-PA 125 GM12796-PA 4..105 8..109 194 36.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:09:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17420-PA 121 GD17420-PA 2..121 1..120 592 95 Plus
Dsim\GD21438-PA 116 GD21438-PA 4..116 2..112 216 42.5 Plus
Dsim\GD21443-PA 125 GD21443-PA 4..105 8..109 197 36.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:09:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11856-PA 131 GJ11856-PA 18..102 23..106 165 37.6 Plus
Dvir\GJ11855-PA 131 GJ11855-PA 18..102 23..106 165 37.6 Plus
Dvir\GJ14220-PA 113 GJ14220-PA 25..111 23..107 131 32.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:09:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17767-PA 121 GE17767-PA 19..118 18..117 397 75 Plus
Dyak\GE23861-PA 125 GE23861-PA 4..106 8..110 208 39.8 Plus
Dyak\GE23853-PA 114 GE23853-PA 3..110 4..109 196 41.7 Plus
Dyak\GE23854-PA 115 GE23854-PA 6..111 5..109 183 36.8 Plus

IP03566.hyp Sequence

Translation from 0 to 362

> IP03566.hyp
RAVSVSVLLILVVWVSCFGESGADCCWTKAKLLFTMGTGSCGMVNAKTTK
YGCEATVCADGRVLKGTYCGVGSCNIIGCFCRGGCLTGNYGESFVEINNR
YQINLISTQMRLANLTDTEA*

IP03566.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:03:58
Subject Length Description Subject Range Query Range Score Percent Strand
Diedel3-PB 121 CG34329-PB 2..121 1..120 650 100 Plus
Diedel3-PA 121 CG34329-PA 2..121 1..120 650 100 Plus
Diedel2-PA 125 CG43228-PA 4..105 8..109 226 37.3 Plus
Diedel-PA 115 CG11501-PA 6..108 5..106 224 41.7 Plus