Clone IP03582 Report

Search the DGRC for IP03582

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:35
Well:82
Vector:pOT2
Associated Gene/TranscriptCG14701-RA
Protein status:IP03582.pep: gold
Preliminary Size:261
Sequenced Size:507

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14701 2005-01-01 Successful iPCR screen
CG14701 2008-04-29 Release 5.5 accounting
CG14701 2008-08-15 Release 5.9 accounting
CG14701 2008-12-18 5.12 accounting

Clone Sequence Records

IP03582.complete Sequence

507 bp (507 high quality bases) assembled on 2004-12-17

GenBank Submission: BT023695

> IP03582.complete
CAACACAACGTGCCCATTTGTTTGGCGTGGATTAATCTAAGTTATCGCAA
AAAAAACTCAAATATAATATGACCTTTAGGCGCTGAATTAAGCTGAAGGT
ACGTCATGAGCATCTATCACGACGAGGTGGAGATCGAGGACTTCGAGTAC
GACGAGGAGGAGGAGATGTACTACTATCCCTGTCCATGCGGCGATCGATT
TCAGATCTCCAAGGAGGAGCTAATCGAGGGCGAGGAGGTGGCCACCTGTC
CCAGCTGCTCCCTAGTCATCAAGGTCATATACGATCCGGAGATGTTCAAA
GCTGAGGAGGATGAAGAAAGTGCGCTGAACGAGAAGCTCGGCGACCTGAA
GCTCGAGAAGAACTAACACACAGTTTGGTGTAATTAAATAGTTTTTATTT
ATATATTTTTATATATATATAGACTTCATTTTAGTGTAAATAATACGATG
ACTAGTAAAACAATGATTTCAAATTATGCAAGCTCGCAAAAAAAAAAAAA
AAAAAAA

IP03582.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:50:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG14701-RA 517 CG14701-RA 22..513 1..492 2460 100 Plus
CG17184-RA 2084 CG17184-RA 1969..2084 492..377 580 100 Minus
CG17184-RB 2176 CG17184-RB 2061..2176 492..377 580 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:11:03
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 7057495..7057708 1..214 1070 100 Plus
chr3R 27901430 chr3R 7057923..7058122 288..487 1000 100 Plus
chr3R 27901430 chr3R 7057775..7057852 212..289 390 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:38:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:11:01
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11231912..11232125 1..214 1070 100 Plus
3R 32079331 3R 11232340..11232544 288..492 1025 100 Plus
3R 32079331 3R 11232192..11232269 212..289 390 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:39:52
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 10972743..10972956 1..214 1070 100 Plus
3R 31820162 3R 10973171..10973375 288..492 1025 100 Plus
3R 31820162 3R 10973023..10973100 212..289 390 100 Plus
Blast to na_te.dros performed 2019-03-16 04:11:02
Subject Length Description Subject Range Query Range Score Percent Strand
invader3 5484 invader3 INVADER3 5484bp 3249..3302 26..79 108 66.7 Plus

IP03582.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:12:06 Download gff for IP03582.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 7057777..7057851 214..288 100 -> Plus
chr3R 7057495..7057707 1..213 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:20:52 Download gff for IP03582.complete
Subject Subject Range Query Range Percent Splice Strand
CG14701-RA 1..261 106..366 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:21:40 Download gff for IP03582.complete
Subject Subject Range Query Range Percent Splice Strand
CG14701-RA 1..261 106..366 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:19:55 Download gff for IP03582.complete
Subject Subject Range Query Range Percent Splice Strand
CG14701-RA 1..261 106..366 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:05:41 Download gff for IP03582.complete
Subject Subject Range Query Range Percent Splice Strand
CG14701-RA 1..261 106..366 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:30:07 Download gff for IP03582.complete
Subject Subject Range Query Range Percent Splice Strand
CG14701-RA 1..261 106..366 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:22:41 Download gff for IP03582.complete
Subject Subject Range Query Range Percent Splice Strand
CG14701-RA 1..261 106..366 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:21:39 Download gff for IP03582.complete
Subject Subject Range Query Range Percent Splice Strand
CG14701-RA 1..487 1..487 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:19:55 Download gff for IP03582.complete
Subject Subject Range Query Range Percent Splice Strand
CG14701-RA 1..487 1..487 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:05:41 Download gff for IP03582.complete
Subject Subject Range Query Range Percent Splice Strand
CG14701-RA 1..261 106..366 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:30:07 Download gff for IP03582.complete
Subject Subject Range Query Range Percent Splice Strand
CG14701-RA 1..487 1..487 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:12:06 Download gff for IP03582.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11232194..11232268 214..288 100 -> Plus
3R 11232341..11232539 289..487 100   Plus
3R 11231912..11232124 1..213 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:12:06 Download gff for IP03582.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11232194..11232268 214..288 100 -> Plus
3R 11232341..11232539 289..487 100   Plus
3R 11231912..11232124 1..213 100 -> Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:12:06 Download gff for IP03582.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11232194..11232268 214..288 100 -> Plus
3R 11232341..11232539 289..487 100   Plus
3R 11231912..11232124 1..213 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:19:55 Download gff for IP03582.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 7057634..7057846 1..213 100 -> Plus
arm_3R 7057916..7057990 214..288 100 -> Plus
arm_3R 7058063..7058261 289..487 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:42:00 Download gff for IP03582.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10972743..10972955 1..213 100 -> Plus
3R 10973025..10973099 214..288 100 -> Plus
3R 10973172..10973370 289..487 100   Plus

IP03582.pep Sequence

Translation from 105 to 365

> IP03582.pep
MSIYHDEVEIEDFEYDEEEEMYYYPCPCGDRFQISKEELIEGEEVATCPS
CSLVIKVIYDPEMFKAEEDEESALNEKLGDLKLEKN*

IP03582.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:49:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16743-PA 86 GF16743-PA 1..86 1..86 422 96.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:49:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18011-PA 86 GG18011-PA 1..86 1..86 324 95.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:49:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14956-PA 86 GH14956-PA 1..86 1..86 312 89.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:36:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG14701-PA 86 CG14701-PA 1..86 1..86 460 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:49:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23701-PA 86 GI23701-PA 1..86 1..86 316 91.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:49:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12572-PA 86 GL12572-PA 1..86 1..86 354 94.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:49:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13188-PA 86 GA13188-PA 1..86 1..86 354 94.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:49:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23929-PA 86 GM23929-PA 1..86 1..86 430 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:49:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20671-PA 86 GD20671-PA 1..86 1..86 430 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:49:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23259-PA 86 GJ23259-PA 1..86 1..86 312 90.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:49:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11143-PA 86 GK11143-PA 1..86 1..86 322 94.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:49:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26082-PA 86 GE26082-PA 1..86 1..86 420 96.5 Plus

IP03582.hyp Sequence

Translation from 105 to 365

> IP03582.hyp
MSIYHDEVEIEDFEYDEEEEMYYYPCPCGDRFQISKEELIEGEEVATCPS
CSLVIKVIYDPEMFKAEEDEESALNEKLGDLKLEKN*

IP03582.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:04:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG14701-PA 86 CG14701-PA 1..86 1..86 460 100 Plus