BDGP Sequence Production Resources |
Search the DGRC for IP03582
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 35 |
Well: | 82 |
Vector: | pOT2 |
Associated Gene/Transcript | CG14701-RA |
Protein status: | IP03582.pep: gold |
Preliminary Size: | 261 |
Sequenced Size: | 507 |
Gene | Date | Evidence |
---|---|---|
CG14701 | 2005-01-01 | Successful iPCR screen |
CG14701 | 2008-04-29 | Release 5.5 accounting |
CG14701 | 2008-08-15 | Release 5.9 accounting |
CG14701 | 2008-12-18 | 5.12 accounting |
507 bp (507 high quality bases) assembled on 2004-12-17
GenBank Submission: BT023695
> IP03582.complete CAACACAACGTGCCCATTTGTTTGGCGTGGATTAATCTAAGTTATCGCAA AAAAAACTCAAATATAATATGACCTTTAGGCGCTGAATTAAGCTGAAGGT ACGTCATGAGCATCTATCACGACGAGGTGGAGATCGAGGACTTCGAGTAC GACGAGGAGGAGGAGATGTACTACTATCCCTGTCCATGCGGCGATCGATT TCAGATCTCCAAGGAGGAGCTAATCGAGGGCGAGGAGGTGGCCACCTGTC CCAGCTGCTCCCTAGTCATCAAGGTCATATACGATCCGGAGATGTTCAAA GCTGAGGAGGATGAAGAAAGTGCGCTGAACGAGAAGCTCGGCGACCTGAA GCTCGAGAAGAACTAACACACAGTTTGGTGTAATTAAATAGTTTTTATTT ATATATTTTTATATATATATAGACTTCATTTTAGTGTAAATAATACGATG ACTAGTAAAACAATGATTTCAAATTATGCAAGCTCGCAAAAAAAAAAAAA AAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 7057495..7057708 | 1..214 | 1070 | 100 | Plus |
chr3R | 27901430 | chr3R | 7057923..7058122 | 288..487 | 1000 | 100 | Plus |
chr3R | 27901430 | chr3R | 7057775..7057852 | 212..289 | 390 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 11231912..11232125 | 1..214 | 1070 | 100 | Plus |
3R | 32079331 | 3R | 11232340..11232544 | 288..492 | 1025 | 100 | Plus |
3R | 32079331 | 3R | 11232192..11232269 | 212..289 | 390 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 10972743..10972956 | 1..214 | 1070 | 100 | Plus |
3R | 31820162 | 3R | 10973171..10973375 | 288..492 | 1025 | 100 | Plus |
3R | 31820162 | 3R | 10973023..10973100 | 212..289 | 390 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
invader3 | 5484 | invader3 INVADER3 5484bp | 3249..3302 | 26..79 | 108 | 66.7 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 7057777..7057851 | 214..288 | 100 | -> | Plus |
chr3R | 7057495..7057707 | 1..213 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14701-RA | 1..261 | 106..366 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14701-RA | 1..261 | 106..366 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14701-RA | 1..261 | 106..366 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14701-RA | 1..261 | 106..366 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14701-RA | 1..261 | 106..366 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14701-RA | 1..261 | 106..366 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14701-RA | 1..487 | 1..487 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14701-RA | 1..487 | 1..487 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14701-RA | 1..261 | 106..366 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG14701-RA | 1..487 | 1..487 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 11232194..11232268 | 214..288 | 100 | -> | Plus |
3R | 11232341..11232539 | 289..487 | 100 | Plus | |
3R | 11231912..11232124 | 1..213 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 11232194..11232268 | 214..288 | 100 | -> | Plus |
3R | 11232341..11232539 | 289..487 | 100 | Plus | |
3R | 11231912..11232124 | 1..213 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 11232194..11232268 | 214..288 | 100 | -> | Plus |
3R | 11232341..11232539 | 289..487 | 100 | Plus | |
3R | 11231912..11232124 | 1..213 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 7057634..7057846 | 1..213 | 100 | -> | Plus |
arm_3R | 7057916..7057990 | 214..288 | 100 | -> | Plus |
arm_3R | 7058063..7058261 | 289..487 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 10972743..10972955 | 1..213 | 100 | -> | Plus |
3R | 10973025..10973099 | 214..288 | 100 | -> | Plus |
3R | 10973172..10973370 | 289..487 | 100 | Plus |
Translation from 105 to 365
> IP03582.pep MSIYHDEVEIEDFEYDEEEEMYYYPCPCGDRFQISKEELIEGEEVATCPS CSLVIKVIYDPEMFKAEEDEESALNEKLGDLKLEKN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF16743-PA | 86 | GF16743-PA | 1..86 | 1..86 | 422 | 96.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG18011-PA | 86 | GG18011-PA | 1..86 | 1..86 | 324 | 95.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14956-PA | 86 | GH14956-PA | 1..86 | 1..86 | 312 | 89.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14701-PA | 86 | CG14701-PA | 1..86 | 1..86 | 460 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23701-PA | 86 | GI23701-PA | 1..86 | 1..86 | 316 | 91.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL12572-PA | 86 | GL12572-PA | 1..86 | 1..86 | 354 | 94.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13188-PA | 86 | GA13188-PA | 1..86 | 1..86 | 354 | 94.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM23929-PA | 86 | GM23929-PA | 1..86 | 1..86 | 430 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD20671-PA | 86 | GD20671-PA | 1..86 | 1..86 | 430 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23259-PA | 86 | GJ23259-PA | 1..86 | 1..86 | 312 | 90.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK11143-PA | 86 | GK11143-PA | 1..86 | 1..86 | 322 | 94.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE26082-PA | 86 | GE26082-PA | 1..86 | 1..86 | 420 | 96.5 | Plus |
Translation from 105 to 365
> IP03582.hyp MSIYHDEVEIEDFEYDEEEEMYYYPCPCGDRFQISKEELIEGEEVATCPS CSLVIKVIYDPEMFKAEEDEESALNEKLGDLKLEKN*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG14701-PA | 86 | CG14701-PA | 1..86 | 1..86 | 460 | 100 | Plus |