BDGP Sequence Production Resources |
Search the DGRC for IP03587
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 35 |
Well: | 87 |
Vector: | pOT2 |
Associated Gene/Transcript | l(3)neo43-RB |
Protein status: | IP03587.pep: gold |
Preliminary Size: | 231 |
Sequenced Size: | 441 |
Gene | Date | Evidence |
---|---|---|
CG14865 | 2005-01-01 | Successful iPCR screen |
l(3)neo43 | 2008-04-29 | Release 5.5 accounting |
l(3)neo43 | 2008-08-15 | Release 5.9 accounting |
l(3)neo43 | 2008-12-18 | 5.12 accounting |
CG14865 | 2011-03-01 | Transcript Validation |
441 bp (441 high quality bases) assembled on 2006-01-24
GenBank Submission: BT024413
> IP03587.complete TAACAACAATGTCTCTCGTGGATAAATTAAACTATTACAGCACACGAAAA TCGTTCAAATATGGCATACCCTTCCTCATCATGATGGTGGCTGGCTCCTT TGGACTGCAGCAGTTCTCCAACCTCAGGTATCAGTACGCCAAGAAGCAGC CGGTAACGCCGGAGGAGATGAAAAAGTACGGCGTAAGCATGAAAAACCGC AAGGATGTGACGTTGGAGTCGGAGTACGACAAAGTCAAGTCCGTGGACAT AGAGAACTGGGAGAACAAACGCGGTCCACGTCCCTGGGAGGAGCAGGAAG ATCAGCCGACGACAGCGAAGCACTAGACTTGATGCCTTCAAAATCATTAA GAAAACAACCCATAAAAACAGACTGTTTGATGTACATAGTCATAAATAAA TCAATATTGTTAATATCTACCAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
l(3)neo43-RB | 506 | l(3)neo43-RB | 40..462 | 1..423 | 2115 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 11102778..11103073 | 126..421 | 100 | -> | Minus |
chr3R | 11103132..11103259 | 1..125 | 97 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(3)neo43-RA | 1..30 | 81..110 | 100 | == | Plus |
l(3)neo43-RA | 31..231 | 125..326 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(3)neo43-RB | 1..246 | 81..326 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(3)neo43-RB | 1..246 | 81..326 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(3)neo43-RA | 1..30 | 81..110 | 100 | == | Plus |
l(3)neo43-RA | 31..231 | 125..326 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(3)neo43-RB | 1..246 | 81..326 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(3)neo43-RA | 31..231 | 125..326 | 99 | Plus | |
l(3)neo43-RA | 1..30 | 81..110 | 100 | == | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(3)neo43-RB | 1..421 | 1..421 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(3)neo43-RB | 1..421 | 1..421 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(3)neo43-RA | 1..30 | 81..110 | 100 | == | Plus |
l(3)neo43-RA | 31..231 | 125..326 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(3)neo43-RB | 40..460 | 1..421 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 15278148..15278443 | 126..421 | 100 | -> | Minus |
3R | 15278502..15278629 | 1..125 | 97 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 15278148..15278443 | 126..421 | 100 | -> | Minus |
3R | 15278502..15278629 | 1..125 | 97 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 15278148..15278443 | 126..421 | 100 | -> | Minus |
3R | 15278502..15278629 | 1..125 | 97 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 11103870..11104165 | 126..421 | 100 | -> | Minus |
arm_3R | 11104224..11104351 | 1..125 | 97 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 15018979..15019274 | 126..421 | 100 | -> | Minus |
3R | 15019333..15019460 | 1..125 | 97 | Minus |
Translation from 2 to 325
> IP03587.hyp TTMSLVDKLNYYSTRKSFKYGIPFLIMMVAGSFGLQQFSNLRRYQYAKKQ PVTPEEMKKYGVSMKNRKDVTLESEYDKVKSVDIENWENKRGPRPWEEQE DQPTTAKH*
Translation from 8 to 325
> IP03587.pep MSLVDKLNYYSTRKSFKYGIPFLIMMVAGSFGLQQFSNLRYQYAKKQPVT PEEMKKYGVSMKNRKDVTLESEYDKVKSVDIENWENKRGPRPWEEQEDQP TTAKH*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11725-PA | 104 | GF11725-PA | 1..104 | 1..105 | 466 | 83.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20715-PA | 105 | GG20715-PA | 1..105 | 1..105 | 546 | 97.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18745-PA | 82 | GH18745-PA | 1..82 | 25..105 | 346 | 78 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
l(3)neo43-PC | 81 | CG14865-PC | 1..81 | 25..105 | 434 | 100 | Plus |
l(3)neo43-PB | 81 | CG14865-PB | 1..81 | 25..105 | 434 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI24662-PA | 109 | GI24662-PA | 1..103 | 1..103 | 430 | 75.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL12067-PA | 80 | GL12067-PA | 1..80 | 25..105 | 335 | 77.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13304-PA | 80 | GA13304-PA | 1..80 | 25..105 | 335 | 77.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25787-PA | 104 | GM25787-PA | 1..104 | 1..105 | 538 | 98.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD20364-PA | 105 | GD20364-PA | 1..105 | 1..105 | 555 | 99 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ24035-PA | 80 | GJ24035-PA | 1..78 | 26..103 | 336 | 78.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK13488-PA | 78 | GK13488-PA | 1..78 | 25..105 | 339 | 79 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE26392-PA | 105 | GE26392-PA | 1..105 | 1..105 | 544 | 96.2 | Plus |