Clone IP03587 Report

Search the DGRC for IP03587

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:35
Well:87
Vector:pOT2
Associated Gene/Transcriptl(3)neo43-RB
Protein status:IP03587.pep: gold
Preliminary Size:231
Sequenced Size:441

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14865 2005-01-01 Successful iPCR screen
l(3)neo43 2008-04-29 Release 5.5 accounting
l(3)neo43 2008-08-15 Release 5.9 accounting
l(3)neo43 2008-12-18 5.12 accounting
CG14865 2011-03-01 Transcript Validation

Clone Sequence Records

IP03587.complete Sequence

441 bp (441 high quality bases) assembled on 2006-01-24

GenBank Submission: BT024413

> IP03587.complete
TAACAACAATGTCTCTCGTGGATAAATTAAACTATTACAGCACACGAAAA
TCGTTCAAATATGGCATACCCTTCCTCATCATGATGGTGGCTGGCTCCTT
TGGACTGCAGCAGTTCTCCAACCTCAGGTATCAGTACGCCAAGAAGCAGC
CGGTAACGCCGGAGGAGATGAAAAAGTACGGCGTAAGCATGAAAAACCGC
AAGGATGTGACGTTGGAGTCGGAGTACGACAAAGTCAAGTCCGTGGACAT
AGAGAACTGGGAGAACAAACGCGGTCCACGTCCCTGGGAGGAGCAGGAAG
ATCAGCCGACGACAGCGAAGCACTAGACTTGATGCCTTCAAAATCATTAA
GAAAACAACCCATAAAAACAGACTGTTTGATGTACATAGTCATAAATAAA
TCAATATTGTTAATATCTACCAAAAAAAAAAAAAAAAAAAA

IP03587.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:20:38
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)neo43-RB 506 l(3)neo43-RB 40..462 1..423 2115 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:41:57
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11102778..11103074 421..125 1485 100 Minus
chr3R 27901430 chr3R 11103132..11103259 128..1 640 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:38:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:41:55
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15278146..15278444 423..125 1495 100 Minus
3R 32079331 3R 15278502..15278629 128..1 640 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:13:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 15018977..15019275 423..125 1495 100 Minus
3R 31820162 3R 15019333..15019460 128..1 640 100 Minus
Blast to na_te.dros performed on 2019-03-16 09:41:55 has no hits.

IP03587.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:43:05 Download gff for IP03587.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11102778..11103073 126..421 100 -> Minus
chr3R 11103132..11103259 1..125 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:20:53 Download gff for IP03587.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo43-RA 1..30 81..110 100 == Plus
l(3)neo43-RA 31..231 125..326 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:36:18 Download gff for IP03587.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo43-RB 1..246 81..326 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:42:05 Download gff for IP03587.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo43-RB 1..246 81..326 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:10:58 Download gff for IP03587.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo43-RA 1..30 81..110 100 == Plus
l(3)neo43-RA 31..231 125..326 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:17:06 Download gff for IP03587.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo43-RB 1..246 81..326 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:07:44 Download gff for IP03587.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo43-RA 31..231 125..326 99   Plus
l(3)neo43-RA 1..30 81..110 100 == Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:36:18 Download gff for IP03587.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo43-RB 1..421 1..421 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:42:05 Download gff for IP03587.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo43-RB 1..421 1..421 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:10:58 Download gff for IP03587.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo43-RA 1..30 81..110 100 == Plus
l(3)neo43-RA 31..231 125..326 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:17:06 Download gff for IP03587.complete
Subject Subject Range Query Range Percent Splice Strand
l(3)neo43-RB 40..460 1..421 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:43:05 Download gff for IP03587.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15278148..15278443 126..421 100 -> Minus
3R 15278502..15278629 1..125 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:43:05 Download gff for IP03587.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15278148..15278443 126..421 100 -> Minus
3R 15278502..15278629 1..125 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:43:05 Download gff for IP03587.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15278148..15278443 126..421 100 -> Minus
3R 15278502..15278629 1..125 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:42:05 Download gff for IP03587.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11103870..11104165 126..421 100 -> Minus
arm_3R 11104224..11104351 1..125 97   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:59:48 Download gff for IP03587.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15018979..15019274 126..421 100 -> Minus
3R 15019333..15019460 1..125 97   Minus

IP03587.hyp Sequence

Translation from 2 to 325

> IP03587.hyp
TTMSLVDKLNYYSTRKSFKYGIPFLIMMVAGSFGLQQFSNLRRYQYAKKQ
PVTPEEMKKYGVSMKNRKDVTLESEYDKVKSVDIENWENKRGPRPWEEQE
DQPTTAKH*

IP03587.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:04:08
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)neo43-PC 81 CG14865-PC 1..81 27..108 422 98.8 Plus
l(3)neo43-PB 81 CG14865-PB 1..81 27..108 422 98.8 Plus

IP03587.pep Sequence

Translation from 8 to 325

> IP03587.pep
MSLVDKLNYYSTRKSFKYGIPFLIMMVAGSFGLQQFSNLRYQYAKKQPVT
PEEMKKYGVSMKNRKDVTLESEYDKVKSVDIENWENKRGPRPWEEQEDQP
TTAKH*

IP03587.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:18:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11725-PA 104 GF11725-PA 1..104 1..105 466 83.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:18:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20715-PA 105 GG20715-PA 1..105 1..105 546 97.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:18:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18745-PA 82 GH18745-PA 1..82 25..105 346 78 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:25:28
Subject Length Description Subject Range Query Range Score Percent Strand
l(3)neo43-PC 81 CG14865-PC 1..81 25..105 434 100 Plus
l(3)neo43-PB 81 CG14865-PB 1..81 25..105 434 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:18:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24662-PA 109 GI24662-PA 1..103 1..103 430 75.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:18:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12067-PA 80 GL12067-PA 1..80 25..105 335 77.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:18:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13304-PA 80 GA13304-PA 1..80 25..105 335 77.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:18:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25787-PA 104 GM25787-PA 1..104 1..105 538 98.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:18:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20364-PA 105 GD20364-PA 1..105 1..105 555 99 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:18:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24035-PA 80 GJ24035-PA 1..78 26..103 336 78.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:18:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13488-PA 78 GK13488-PA 1..78 25..105 339 79 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:18:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26392-PA 105 GE26392-PA 1..105 1..105 544 96.2 Plus