IP03589.complete Sequence
441 bp (441 high quality bases) assembled on 2005-03-01
GenBank Submission: BT023137
> IP03589.complete
CAAGGTTAAATTGACAATGTGGACGAGTCTAATTGTATCACTGCTCCTGG
TCCACTGCCTGCTTGCCGGGGCCGCGCCTGCGCTAAAGGATCTGGACGCG
GGCACCTGGAGTGCGGATGAGGCGTGTCAGAATGTGGATAAATCGGTCAT
AATAGCGAACCAGAATGACTCCACATGCGTCAGCTACGTCTATTGTTATA
AAGTCAATGACTCAACGAGGGCTCTAATCAAAAGCTGCAAGACCGGGCAA
TTCTTTGATGCCGATCTCAAATTCTGCACTATCAGCAAACCAGCGGGATG
TGTCTAATATGAGAAAGTCTTAGTTAGAAATACGTTTGAATAGTAATTCA
CTAGATTTTACATATGTATTATTAATTTATTACATTAAAACCCAAAAATT
AAATATTTTTCGATTACCTAAGCAAAAAAAAAAAAAAAAAA
IP03589.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:22:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14957-RA | 576 | CG14957-RA | 152..576 | 1..425 | 2125 | 100 | Plus |
CG42525.a | 1365 | CG42525.a | 1282..1365 | 425..342 | 420 | 100 | Minus |
CG42525-RA | 1491 | CG42525-RA | 1408..1491 | 425..342 | 420 | 100 | Minus |
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:08:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3L | 24539361 | chr3L | 3187292..3187535 | 180..423 | 1190 | 99.2 | Plus |
chr3L | 24539361 | chr3L | 3187097..3187237 | 43..183 | 705 | 100 | Plus |
chr3L | 24539361 | chr3L | 3186992..3187034 | 1..43 | 215 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:38:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:08:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 3187863..3188108 | 180..425 | 1230 | 100 | Plus |
3L | 28110227 | 3L | 3187668..3187808 | 43..183 | 705 | 100 | Plus |
3L | 28110227 | 3L | 3187563..3187605 | 1..43 | 215 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:15:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28103327 | 3L | 3187863..3188108 | 180..425 | 1230 | 100 | Plus |
3L | 28103327 | 3L | 3187668..3187808 | 43..183 | 705 | 100 | Plus |
3L | 28103327 | 3L | 3187563..3187605 | 1..43 | 215 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-15 18:08:49 has no hits.
IP03589.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:09:38 Download gff for
IP03589.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3L | 3186992..3187034 | 1..43 | 100 | -> | Plus |
chr3L | 3187098..3187237 | 44..183 | 100 | -> | Plus |
chr3L | 3187296..3187535 | 184..423 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:40:11 Download gff for
IP03589.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14957-RA | 1..291 | 17..307 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:54:20 Download gff for
IP03589.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14957-RA | 1..291 | 17..307 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:15:49 Download gff for
IP03589.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14957-RA | 1..291 | 17..307 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:54:03 Download gff for
IP03589.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14957-RA | 1..291 | 17..307 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:12:40 Download gff for
IP03589.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14957-RA | 1..423 | 1..423 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:40:11 Download gff for
IP03589.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14957-RA | 1..423 | 1..423 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:54:20 Download gff for
IP03589.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14957-RA | 1..423 | 1..423 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:15:50 Download gff for
IP03589.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14957-RA | 1..423 | 1..423 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:54:03 Download gff for
IP03589.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG14957-RA | 1..423 | 1..423 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:09:38 Download gff for
IP03589.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3187563..3187605 | 1..43 | 100 | -> | Plus |
3L | 3187669..3187808 | 44..183 | 100 | -> | Plus |
3L | 3187867..3188106 | 184..423 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:09:38 Download gff for
IP03589.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3187563..3187605 | 1..43 | 100 | -> | Plus |
3L | 3187669..3187808 | 44..183 | 100 | -> | Plus |
3L | 3187867..3188106 | 184..423 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:09:38 Download gff for
IP03589.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3187563..3187605 | 1..43 | 100 | -> | Plus |
3L | 3187669..3187808 | 44..183 | 100 | -> | Plus |
3L | 3187867..3188106 | 184..423 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:54:20 Download gff for
IP03589.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 3187563..3187605 | 1..43 | 100 | -> | Plus |
arm_3L | 3187669..3187808 | 44..183 | 100 | -> | Plus |
arm_3L | 3187867..3188106 | 184..423 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:02:45 Download gff for
IP03589.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3187867..3188106 | 184..423 | 100 | | Plus |
3L | 3187563..3187605 | 1..43 | 100 | -> | Plus |
3L | 3187669..3187808 | 44..183 | 100 | -> | Plus |
IP03589.hyp Sequence
Translation from 0 to 306
> IP03589.hyp
KVKLTMWTSLIVSLLLVHCLLAGAAPALKDLDAGTWSADEACQNVDKSVI
IANQNDSTCVSYVYCYKVNDSTRALIKSCKTGQFFDADLKFCTISKPAGC
V*
IP03589.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:04:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14957-PA | 96 | CG14957-PA | 1..96 | 6..101 | 509 | 100 | Plus |
CG32284-PA | 102 | CG32284-PA | 1..95 | 6..100 | 254 | 50.5 | Plus |
CG42494-PC | 283 | CG42494-PC | 215..282 | 33..100 | 204 | 51.5 | Plus |
CG42494-PB | 283 | CG42494-PB | 215..282 | 33..100 | 204 | 51.5 | Plus |
CG42494-PA | 283 | CG42494-PA | 215..282 | 33..100 | 204 | 51.5 | Plus |
CG42494-PC | 283 | CG42494-PC | 123..189 | 36..101 | 160 | 40.3 | Plus |
CG42494-PB | 283 | CG42494-PB | 123..189 | 36..101 | 160 | 40.3 | Plus |
IP03589.pep Sequence
Translation from 16 to 306
> IP03589.pep
MWTSLIVSLLLVHCLLAGAAPALKDLDAGTWSADEACQNVDKSVIIANQN
DSTCVSYVYCYKVNDSTRALIKSCKTGQFFDADLKFCTISKPAGCV*
IP03589.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:28:09
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF10120-PA | 94 | GF10120-PA | 1..93 | 1..95 | 259 | 49.5 | Plus |
Dana\GF10119-PA | 1575 | GF10119-PA | 1449..1517 | 28..96 | 142 | 31.9 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:28:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG15110-PA | 95 | GG15110-PA | 1..95 | 1..96 | 399 | 80.2 | Plus |
Dere\GG15109-PA | 251 | GG15109-PA | 185..251 | 31..96 | 162 | 49.3 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG14957-PA | 96 | CG14957-PA | 1..96 | 1..96 | 509 | 100 | Plus |
CG32284-PA | 102 | CG32284-PA | 1..95 | 1..95 | 254 | 50.5 | Plus |
CG42494-PC | 283 | CG42494-PC | 215..282 | 28..95 | 204 | 51.5 | Plus |
CG42494-PB | 283 | CG42494-PB | 215..282 | 28..95 | 204 | 51.5 | Plus |
CG42494-PA | 283 | CG42494-PA | 215..282 | 28..95 | 204 | 51.5 | Plus |
CG42494-PC | 283 | CG42494-PC | 123..189 | 31..96 | 160 | 40.3 | Plus |
CG42494-PB | 283 | CG42494-PB | 123..189 | 31..96 | 160 | 40.3 | Plus |
CG42494-PA | 283 | CG42494-PA | 123..189 | 31..96 | 160 | 40.3 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:28:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL24893-PA | 91 | GL24893-PA | 1..91 | 1..96 | 160 | 38.5 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:28:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA30028-PB | 237 | GA30028-PB | 79..145 | 31..96 | 163 | 44.8 | Plus |
Dpse\GA30028-PB | 237 | GA30028-PB | 171..237 | 31..96 | 159 | 44.8 | Plus |
Dpse\GA16810-PB | 90 | GA16810-PB | 22..90 | 28..96 | 154 | 44.9 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:28:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM14546-PA | 96 | GM14546-PA | 1..96 | 1..96 | 464 | 90.6 | Plus |
Dsec\GM14544-PA | 102 | GM14544-PA | 1..95 | 1..95 | 257 | 49.5 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:28:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD13737-PA | 96 | GD13737-PA | 1..96 | 1..96 | 462 | 89.6 | Plus |
Dsim\GD13736-PA | 105 | GD13736-PA | 1..95 | 1..95 | 246 | 47.4 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:28:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK19152-PA | 90 | GK19152-PA | 19..88 | 27..96 | 168 | 42.9 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:28:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE21337-PA | 96 | GE21337-PA | 1..96 | 1..96 | 401 | 79.2 | Plus |
Dyak\GE21336-PA | 147 | GE21336-PA | 1..95 | 1..95 | 202 | 47.4 | Plus |