Clone IP03589 Report

Search the DGRC for IP03589

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:35
Well:89
Vector:pOT2
Associated Gene/TranscriptCG14957-RA
Protein status:IP03589.pep: gold
Preliminary Size:291
Sequenced Size:441

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14957 2005-01-01 Successful iPCR screen
CG14957 2008-04-29 Release 5.5 accounting
CG14957 2008-08-15 Release 5.9 accounting
CG14957 2008-12-18 5.12 accounting

Clone Sequence Records

IP03589.complete Sequence

441 bp (441 high quality bases) assembled on 2005-03-01

GenBank Submission: BT023137

> IP03589.complete
CAAGGTTAAATTGACAATGTGGACGAGTCTAATTGTATCACTGCTCCTGG
TCCACTGCCTGCTTGCCGGGGCCGCGCCTGCGCTAAAGGATCTGGACGCG
GGCACCTGGAGTGCGGATGAGGCGTGTCAGAATGTGGATAAATCGGTCAT
AATAGCGAACCAGAATGACTCCACATGCGTCAGCTACGTCTATTGTTATA
AAGTCAATGACTCAACGAGGGCTCTAATCAAAAGCTGCAAGACCGGGCAA
TTCTTTGATGCCGATCTCAAATTCTGCACTATCAGCAAACCAGCGGGATG
TGTCTAATATGAGAAAGTCTTAGTTAGAAATACGTTTGAATAGTAATTCA
CTAGATTTTACATATGTATTATTAATTTATTACATTAAAACCCAAAAATT
AAATATTTTTCGATTACCTAAGCAAAAAAAAAAAAAAAAAA

IP03589.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:22:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG14957-RA 576 CG14957-RA 152..576 1..425 2125 100 Plus
CG42525.a 1365 CG42525.a 1282..1365 425..342 420 100 Minus
CG42525-RA 1491 CG42525-RA 1408..1491 425..342 420 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:08:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3187292..3187535 180..423 1190 99.2 Plus
chr3L 24539361 chr3L 3187097..3187237 43..183 705 100 Plus
chr3L 24539361 chr3L 3186992..3187034 1..43 215 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:38:30 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:08:49
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3187863..3188108 180..425 1230 100 Plus
3L 28110227 3L 3187668..3187808 43..183 705 100 Plus
3L 28110227 3L 3187563..3187605 1..43 215 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:15:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3187863..3188108 180..425 1230 100 Plus
3L 28103327 3L 3187668..3187808 43..183 705 100 Plus
3L 28103327 3L 3187563..3187605 1..43 215 100 Plus
Blast to na_te.dros performed on 2019-03-15 18:08:49 has no hits.

IP03589.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:09:38 Download gff for IP03589.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3186992..3187034 1..43 100 -> Plus
chr3L 3187098..3187237 44..183 100 -> Plus
chr3L 3187296..3187535 184..423 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:40:11 Download gff for IP03589.complete
Subject Subject Range Query Range Percent Splice Strand
CG14957-RA 1..291 17..307 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:54:20 Download gff for IP03589.complete
Subject Subject Range Query Range Percent Splice Strand
CG14957-RA 1..291 17..307 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:15:49 Download gff for IP03589.complete
Subject Subject Range Query Range Percent Splice Strand
CG14957-RA 1..291 17..307 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:54:03 Download gff for IP03589.complete
Subject Subject Range Query Range Percent Splice Strand
CG14957-RA 1..291 17..307 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:12:40 Download gff for IP03589.complete
Subject Subject Range Query Range Percent Splice Strand
CG14957-RA 1..423 1..423 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:40:11 Download gff for IP03589.complete
Subject Subject Range Query Range Percent Splice Strand
CG14957-RA 1..423 1..423 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:54:20 Download gff for IP03589.complete
Subject Subject Range Query Range Percent Splice Strand
CG14957-RA 1..423 1..423 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:15:50 Download gff for IP03589.complete
Subject Subject Range Query Range Percent Splice Strand
CG14957-RA 1..423 1..423 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:54:03 Download gff for IP03589.complete
Subject Subject Range Query Range Percent Splice Strand
CG14957-RA 1..423 1..423 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:09:38 Download gff for IP03589.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3187563..3187605 1..43 100 -> Plus
3L 3187669..3187808 44..183 100 -> Plus
3L 3187867..3188106 184..423 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:09:38 Download gff for IP03589.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3187563..3187605 1..43 100 -> Plus
3L 3187669..3187808 44..183 100 -> Plus
3L 3187867..3188106 184..423 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:09:38 Download gff for IP03589.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3187563..3187605 1..43 100 -> Plus
3L 3187669..3187808 44..183 100 -> Plus
3L 3187867..3188106 184..423 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:54:20 Download gff for IP03589.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3187563..3187605 1..43 100 -> Plus
arm_3L 3187669..3187808 44..183 100 -> Plus
arm_3L 3187867..3188106 184..423 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:02:45 Download gff for IP03589.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3187867..3188106 184..423 100   Plus
3L 3187563..3187605 1..43 100 -> Plus
3L 3187669..3187808 44..183 100 -> Plus

IP03589.hyp Sequence

Translation from 0 to 306

> IP03589.hyp
KVKLTMWTSLIVSLLLVHCLLAGAAPALKDLDAGTWSADEACQNVDKSVI
IANQNDSTCVSYVYCYKVNDSTRALIKSCKTGQFFDADLKFCTISKPAGC
V*

IP03589.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:04:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG14957-PA 96 CG14957-PA 1..96 6..101 509 100 Plus
CG32284-PA 102 CG32284-PA 1..95 6..100 254 50.5 Plus
CG42494-PC 283 CG42494-PC 215..282 33..100 204 51.5 Plus
CG42494-PB 283 CG42494-PB 215..282 33..100 204 51.5 Plus
CG42494-PA 283 CG42494-PA 215..282 33..100 204 51.5 Plus
CG42494-PC 283 CG42494-PC 123..189 36..101 160 40.3 Plus
CG42494-PB 283 CG42494-PB 123..189 36..101 160 40.3 Plus

IP03589.pep Sequence

Translation from 16 to 306

> IP03589.pep
MWTSLIVSLLLVHCLLAGAAPALKDLDAGTWSADEACQNVDKSVIIANQN
DSTCVSYVYCYKVNDSTRALIKSCKTGQFFDADLKFCTISKPAGCV*

IP03589.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:28:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10120-PA 94 GF10120-PA 1..93 1..95 259 49.5 Plus
Dana\GF10119-PA 1575 GF10119-PA 1449..1517 28..96 142 31.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:28:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15110-PA 95 GG15110-PA 1..95 1..96 399 80.2 Plus
Dere\GG15109-PA 251 GG15109-PA 185..251 31..96 162 49.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG14957-PA 96 CG14957-PA 1..96 1..96 509 100 Plus
CG32284-PA 102 CG32284-PA 1..95 1..95 254 50.5 Plus
CG42494-PC 283 CG42494-PC 215..282 28..95 204 51.5 Plus
CG42494-PB 283 CG42494-PB 215..282 28..95 204 51.5 Plus
CG42494-PA 283 CG42494-PA 215..282 28..95 204 51.5 Plus
CG42494-PC 283 CG42494-PC 123..189 31..96 160 40.3 Plus
CG42494-PB 283 CG42494-PB 123..189 31..96 160 40.3 Plus
CG42494-PA 283 CG42494-PA 123..189 31..96 160 40.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:28:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24893-PA 91 GL24893-PA 1..91 1..96 160 38.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:28:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA30028-PB 237 GA30028-PB 79..145 31..96 163 44.8 Plus
Dpse\GA30028-PB 237 GA30028-PB 171..237 31..96 159 44.8 Plus
Dpse\GA16810-PB 90 GA16810-PB 22..90 28..96 154 44.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:28:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14546-PA 96 GM14546-PA 1..96 1..96 464 90.6 Plus
Dsec\GM14544-PA 102 GM14544-PA 1..95 1..95 257 49.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:28:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13737-PA 96 GD13737-PA 1..96 1..96 462 89.6 Plus
Dsim\GD13736-PA 105 GD13736-PA 1..95 1..95 246 47.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:28:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19152-PA 90 GK19152-PA 19..88 27..96 168 42.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:28:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21337-PA 96 GE21337-PA 1..96 1..96 401 79.2 Plus
Dyak\GE21336-PA 147 GE21336-PA 1..95 1..95 202 47.4 Plus