IP03592.complete Sequence
345 bp (345 high quality bases) assembled on 2004-12-17
GenBank Submission: BT023696
> IP03592.complete
AATTCTCGGGCCGAGGATCACGATGAGGCAATCCATAAAGCACATATTCG
CACTGTTGGTTGCCCTGGAGTGTTTAAGCCTTGGCGACACGGCGCCCATC
GGTGAGCATCCGGATCATGCCGGATGTATACGGATAACGATCATCAAGCG
ACCATTGGCCACCACCACCACCACGACAACAACAACAACTACAACCACAA
CAACCACTACAACCAGAGCAACAACCACGGCCGCTGGTTAAAAAGGAATA
TTCTAAATTCAACACAAACAATTTGTAGAAATACACTTAGCTCCTCTGAT
CAACGCTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
IP03592.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:50:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15036-RA | 308 | CG15036-RA | 1..308 | 1..308 | 1540 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:24:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chrX | 22417052 | chrX | 7316458..7316765 | 308..1 | 1540 | 100 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:38:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:24:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 7424525..7424834 | 310..1 | 1550 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:39:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23527363 | X | 7432623..7432932 | 310..1 | 1550 | 100 | Minus |
2R | 25260384 | 2R | 10042887..10042955 | 229..161 | 195 | 85.5 | Minus |
2R | 25260384 | 2R | 10042845..10042913 | 229..161 | 195 | 85.5 | Minus |
Blast to na_te.dros performed on 2019-03-16 16:24:12 has no hits.
IP03592.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:25:11 Download gff for
IP03592.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chrX | 7316458..7316540 | 226..308 | 100 | == | Minus |
chrX | 7316594..7316765 | 1..172 | 100 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:20:55 Download gff for
IP03592.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15036-RA | 1..219 | 23..241 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:21:41 Download gff for
IP03592.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15036-RA | 1..219 | 23..241 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:09:15 Download gff for
IP03592.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15036-RA | 1..219 | 23..241 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:05:42 Download gff for
IP03592.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15036-RA | 1..219 | 23..241 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:26:26 Download gff for
IP03592.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15036-RA | 1..219 | 23..241 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:22:42 Download gff for
IP03592.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15036-RA | 1..219 | 23..241 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:21:41 Download gff for
IP03592.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15036-RA | 9..316 | 1..308 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:09:15 Download gff for
IP03592.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15036-RA | 9..316 | 1..308 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:05:42 Download gff for
IP03592.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15036-RA | 1..219 | 23..241 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:26:26 Download gff for
IP03592.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15036-RA | 9..316 | 1..308 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:25:11 Download gff for
IP03592.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 7424527..7424834 | 1..308 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:25:11 Download gff for
IP03592.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 7424527..7424834 | 1..308 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:25:11 Download gff for
IP03592.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 7424527..7424834 | 1..308 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:09:15 Download gff for
IP03592.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 7318560..7318867 | 1..308 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:42:01 Download gff for
IP03592.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 7432625..7432932 | 1..308 | 100 | | Minus |
IP03592.hyp Sequence
Translation from 0 to 240
> IP03592.hyp
ILGPRITMRQSIKHIFALLVALECLSLGDTAPIGEHPDHAGCIRITIIKR
PLATTTTTTTTTTTTTTTTTTRATTTAAG*
IP03592.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:04:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15036-PA | 72 | CG15036-PA | 1..72 | 8..79 | 366 | 100 | Plus |
IP03592.pep Sequence
Translation from 1 to 240
> IP03592.pep
ILGPRITMRQSIKHIFALLVALECLSLGDTAPIGEHPDHAGCIRITIIKR
PLATTTTTTTTTTTTTTTTTTRATTTAAG*
IP03592.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:49:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG17621-PA | 70 | GG17621-PA | 1..45 | 8..52 | 212 | 86.7 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:58:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15036-PA | 72 | CG15036-PA | 1..72 | 8..79 | 366 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:49:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM17468-PA | 91 | GM17468-PA | 15..67 | 1..53 | 270 | 94.3 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:49:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD16154-PA | 91 | GD16154-PA | 15..67 | 1..53 | 270 | 94.3 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:49:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK19247-PA | 83 | GK19247-PA | 10..47 | 15..52 | 130 | 63.2 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:49:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE17523-PA | 71 | GE17523-PA | 1..45 | 8..52 | 221 | 88.9 | Plus |