Clone IP03592 Report

Search the DGRC for IP03592

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:35
Well:92
Vector:pOT2
Associated Gene/TranscriptCG15036-RA
Protein status:IP03592.pep: gold
Preliminary Size:219
Sequenced Size:345

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15036 2005-01-01 Successful iPCR screen
CG15036 2008-04-29 Release 5.5 accounting
CG15036 2008-08-15 Release 5.9 accounting
CG15036 2008-12-18 5.12 accounting

Clone Sequence Records

IP03592.complete Sequence

345 bp (345 high quality bases) assembled on 2004-12-17

GenBank Submission: BT023696

> IP03592.complete
AATTCTCGGGCCGAGGATCACGATGAGGCAATCCATAAAGCACATATTCG
CACTGTTGGTTGCCCTGGAGTGTTTAAGCCTTGGCGACACGGCGCCCATC
GGTGAGCATCCGGATCATGCCGGATGTATACGGATAACGATCATCAAGCG
ACCATTGGCCACCACCACCACCACGACAACAACAACAACTACAACCACAA
CAACCACTACAACCAGAGCAACAACCACGGCCGCTGGTTAAAAAGGAATA
TTCTAAATTCAACACAAACAATTTGTAGAAATACACTTAGCTCCTCTGAT
CAACGCTTAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP03592.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:50:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG15036-RA 308 CG15036-RA 1..308 1..308 1540 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:24:14
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 7316458..7316765 308..1 1540 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:38:31 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:24:12
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7424525..7424834 310..1 1550 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:39:52
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 7432623..7432932 310..1 1550 100 Minus
2R 25260384 2R 10042887..10042955 229..161 195 85.5 Minus
2R 25260384 2R 10042845..10042913 229..161 195 85.5 Minus
Blast to na_te.dros performed on 2019-03-16 16:24:12 has no hits.

IP03592.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 16:25:11 Download gff for IP03592.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 7316458..7316540 226..308 100 == Minus
chrX 7316594..7316765 1..172 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:20:55 Download gff for IP03592.complete
Subject Subject Range Query Range Percent Splice Strand
CG15036-RA 1..219 23..241 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:21:41 Download gff for IP03592.complete
Subject Subject Range Query Range Percent Splice Strand
CG15036-RA 1..219 23..241 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:09:15 Download gff for IP03592.complete
Subject Subject Range Query Range Percent Splice Strand
CG15036-RA 1..219 23..241 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:05:42 Download gff for IP03592.complete
Subject Subject Range Query Range Percent Splice Strand
CG15036-RA 1..219 23..241 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:26:26 Download gff for IP03592.complete
Subject Subject Range Query Range Percent Splice Strand
CG15036-RA 1..219 23..241 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:22:42 Download gff for IP03592.complete
Subject Subject Range Query Range Percent Splice Strand
CG15036-RA 1..219 23..241 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:21:41 Download gff for IP03592.complete
Subject Subject Range Query Range Percent Splice Strand
CG15036-RA 9..316 1..308 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:09:15 Download gff for IP03592.complete
Subject Subject Range Query Range Percent Splice Strand
CG15036-RA 9..316 1..308 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:05:42 Download gff for IP03592.complete
Subject Subject Range Query Range Percent Splice Strand
CG15036-RA 1..219 23..241 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:26:26 Download gff for IP03592.complete
Subject Subject Range Query Range Percent Splice Strand
CG15036-RA 9..316 1..308 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:25:11 Download gff for IP03592.complete
Subject Subject Range Query Range Percent Splice Strand
X 7424527..7424834 1..308 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:25:11 Download gff for IP03592.complete
Subject Subject Range Query Range Percent Splice Strand
X 7424527..7424834 1..308 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:25:11 Download gff for IP03592.complete
Subject Subject Range Query Range Percent Splice Strand
X 7424527..7424834 1..308 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:09:15 Download gff for IP03592.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7318560..7318867 1..308 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:42:01 Download gff for IP03592.complete
Subject Subject Range Query Range Percent Splice Strand
X 7432625..7432932 1..308 100   Minus

IP03592.hyp Sequence

Translation from 0 to 240

> IP03592.hyp
ILGPRITMRQSIKHIFALLVALECLSLGDTAPIGEHPDHAGCIRITIIKR
PLATTTTTTTTTTTTTTTTTTRATTTAAG*

IP03592.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:04:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG15036-PA 72 CG15036-PA 1..72 8..79 366 100 Plus

IP03592.pep Sequence

Translation from 1 to 240

> IP03592.pep
ILGPRITMRQSIKHIFALLVALECLSLGDTAPIGEHPDHAGCIRITIIKR
PLATTTTTTTTTTTTTTTTTTRATTTAAG*

IP03592.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:49:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17621-PA 70 GG17621-PA 1..45 8..52 212 86.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:58:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG15036-PA 72 CG15036-PA 1..72 8..79 366 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:49:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17468-PA 91 GM17468-PA 15..67 1..53 270 94.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:49:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16154-PA 91 GD16154-PA 15..67 1..53 270 94.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:49:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19247-PA 83 GK19247-PA 10..47 15..52 130 63.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:49:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17523-PA 71 GE17523-PA 1..45 8..52 221 88.9 Plus