BDGP Sequence Production Resources |
Search the DGRC for IP03601
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 36 |
Well: | 1 |
Vector: | pOT2 |
Associated Gene/Transcript | CG15127-RA |
Protein status: | IP03601.pep: gold |
Preliminary Size: | 258 |
Sequenced Size: | 625 |
Gene | Date | Evidence |
---|---|---|
CG15127 | 2005-01-01 | Successful iPCR screen |
CG15127 | 2008-04-29 | Release 5.5 accounting |
CG15127 | 2008-08-15 | Release 5.9 accounting |
CG15127 | 2008-12-18 | 5.12 accounting |
625 bp (625 high quality bases) assembled on 2005-03-01
GenBank Submission: BT023133
> IP03601.complete CCGAACGGGGCTCACTTAGTCGAGCAGTTTAGGCCAGTTACTAGTTATCA ACTAGGAGTTTCCGTCATTAAATTAGTAAAAAAGTAAAACAAGGAGAATG TACAACGCAGGCTACCAGGTGGACGTGATCGATCCCTACTATCAGCCGCC CGTGGAGGTGGTGAATGTTATTGGACCCCCGCCCCCCGTAGAGGTGATAA TGCCCTCGCCCGTTTACAACCAGCCGGTGGTTGTGGTGGAGCAACCCAGC TACAATCAGCCAGGACCCCCCCAAGGACCCAGTGACGCCGAGTGCTGCAT GCTGCTAGGAGCCTGTTGTGTCATGGAGGAGTGTGGCCTGTGTGTCATCA TGTAGATTGTGTTGTTGTCAAATGATTGCTATAAGAACTATGTAAACTAA ACGCTAAATATATAGACTGAAACTAAGGATGACTAATCGGAGTGATGATT CAAAGTTTGCATTCAAAGCAAAGTTTTAAAAGCATATCAATTTAATATAC GATGCATTAATGGAAAGTCGAACAAGTTGGTTTTAAGTGCTGAACCTTAT TTTGATATGGTAATACAAAGTGCTTTTGTTAACAATAAATGTTTTATTTC AATTTCAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15127-RA | 607 | CG15127-RA | 1..607 | 1..607 | 3035 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 15567982..15568587 | 606..1 | 2955 | 99.2 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 19680767..19681373 | 607..1 | 3035 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 19681966..19682572 | 607..1 | 3035 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 15567982..15568587 | 1..606 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15127-RA | 1..258 | 98..355 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15127-RA | 1..258 | 98..355 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15127-RA | 1..258 | 98..355 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15127-RA | 1..258 | 98..355 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15127-RA | 1..258 | 98..355 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15127-RA | 1..606 | 1..606 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15127-RA | 1..606 | 1..606 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15127-RA | 19..624 | 1..606 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15127-RA | 1..606 | 1..606 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15127-RA | 19..624 | 1..606 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 19680768..19681373 | 1..606 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 19680768..19681373 | 1..606 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 19680768..19681373 | 1..606 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 15568273..15568878 | 1..606 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 19681967..19682572 | 1..606 | 100 | Minus |
Translation from 97 to 354
> IP03601.pep MYNAGYQVDVIDPYYQPPVEVVNVIGPPPPVEVIMPSPVYNQPVVVVEQP SYNQPGPPQGPSDAECCMLLGACCVMEECGLCVIM*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13171-PA | 83 | GF13171-PA | 1..82 | 1..84 | 252 | 82.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20895-PA | 85 | GG20895-PA | 1..85 | 1..85 | 381 | 90.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH22766-PA | 85 | GH22766-PA | 1..80 | 1..78 | 140 | 47.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15127-PA | 85 | CG15127-PA | 1..85 | 1..85 | 476 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18543-PA | 76 | GI18543-PA | 1..76 | 1..85 | 184 | 54 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11727-PA | 86 | GL11727-PA | 3..85 | 2..84 | 283 | 72.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13515-PA | 86 | GA13515-PA | 3..85 | 2..84 | 288 | 72.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM19818-PA | 85 | GM19818-PA | 1..85 | 1..85 | 409 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD25310-PA | 85 | GD25310-PA | 1..85 | 1..85 | 409 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ21413-PA | 77 | GJ21413-PA | 1..76 | 1..84 | 193 | 54.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK15886-PA | 70 | GK15886-PA | 1..50 | 1..48 | 129 | 70 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13834-PA | 85 | GE13834-PA | 1..85 | 1..85 | 398 | 97.6 | Plus |
Translation from 97 to 354
> IP03601.hyp MYNAGYQVDVIDPYYQPPVEVVNVIGPPPPVEVIMPSPVYNQPVVVVEQP SYNQPGPPQGPSDAECCMLLGACCVMEECGLCVIM*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15127-PA | 85 | CG15127-PA | 1..85 | 1..85 | 476 | 100 | Plus |