Clone IP03601 Report

Search the DGRC for IP03601

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:36
Well:1
Vector:pOT2
Associated Gene/TranscriptCG15127-RA
Protein status:IP03601.pep: gold
Preliminary Size:258
Sequenced Size:625

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15127 2005-01-01 Successful iPCR screen
CG15127 2008-04-29 Release 5.5 accounting
CG15127 2008-08-15 Release 5.9 accounting
CG15127 2008-12-18 5.12 accounting

Clone Sequence Records

IP03601.complete Sequence

625 bp (625 high quality bases) assembled on 2005-03-01

GenBank Submission: BT023133

> IP03601.complete
CCGAACGGGGCTCACTTAGTCGAGCAGTTTAGGCCAGTTACTAGTTATCA
ACTAGGAGTTTCCGTCATTAAATTAGTAAAAAAGTAAAACAAGGAGAATG
TACAACGCAGGCTACCAGGTGGACGTGATCGATCCCTACTATCAGCCGCC
CGTGGAGGTGGTGAATGTTATTGGACCCCCGCCCCCCGTAGAGGTGATAA
TGCCCTCGCCCGTTTACAACCAGCCGGTGGTTGTGGTGGAGCAACCCAGC
TACAATCAGCCAGGACCCCCCCAAGGACCCAGTGACGCCGAGTGCTGCAT
GCTGCTAGGAGCCTGTTGTGTCATGGAGGAGTGTGGCCTGTGTGTCATCA
TGTAGATTGTGTTGTTGTCAAATGATTGCTATAAGAACTATGTAAACTAA
ACGCTAAATATATAGACTGAAACTAAGGATGACTAATCGGAGTGATGATT
CAAAGTTTGCATTCAAAGCAAAGTTTTAAAAGCATATCAATTTAATATAC
GATGCATTAATGGAAAGTCGAACAAGTTGGTTTTAAGTGCTGAACCTTAT
TTTGATATGGTAATACAAAGTGCTTTTGTTAACAATAAATGTTTTATTTC
AATTTCAAAAAAAAAAAAAAAAAAA

IP03601.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:54:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG15127-RA 607 CG15127-RA 1..607 1..607 3035 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 21:47:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 15567982..15568587 606..1 2955 99.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:38:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 21:47:12
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19680767..19681373 607..1 3035 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:43:05
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 19681966..19682572 607..1 3035 100 Minus
Blast to na_te.dros performed on 2019-03-15 21:47:13 has no hits.

IP03601.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 21:48:25 Download gff for IP03601.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 15567982..15568587 1..606 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:20:56 Download gff for IP03601.complete
Subject Subject Range Query Range Percent Splice Strand
CG15127-RA 1..258 98..355 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:26:39 Download gff for IP03601.complete
Subject Subject Range Query Range Percent Splice Strand
CG15127-RA 1..258 98..355 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 05:57:36 Download gff for IP03601.complete
Subject Subject Range Query Range Percent Splice Strand
CG15127-RA 1..258 98..355 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:10:43 Download gff for IP03601.complete
Subject Subject Range Query Range Percent Splice Strand
CG15127-RA 1..258 98..355 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:02:22 Download gff for IP03601.complete
Subject Subject Range Query Range Percent Splice Strand
CG15127-RA 1..258 98..355 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:29:35 Download gff for IP03601.complete
Subject Subject Range Query Range Percent Splice Strand
CG15127-RA 1..606 1..606 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:26:39 Download gff for IP03601.complete
Subject Subject Range Query Range Percent Splice Strand
CG15127-RA 1..606 1..606 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 05:57:36 Download gff for IP03601.complete
Subject Subject Range Query Range Percent Splice Strand
CG15127-RA 19..624 1..606 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:10:44 Download gff for IP03601.complete
Subject Subject Range Query Range Percent Splice Strand
CG15127-RA 1..606 1..606 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:02:22 Download gff for IP03601.complete
Subject Subject Range Query Range Percent Splice Strand
CG15127-RA 19..624 1..606 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:48:25 Download gff for IP03601.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19680768..19681373 1..606 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:48:25 Download gff for IP03601.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19680768..19681373 1..606 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 21:48:25 Download gff for IP03601.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19680768..19681373 1..606 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 05:57:36 Download gff for IP03601.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15568273..15568878 1..606 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:47:13 Download gff for IP03601.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19681967..19682572 1..606 100   Minus

IP03601.pep Sequence

Translation from 97 to 354

> IP03601.pep
MYNAGYQVDVIDPYYQPPVEVVNVIGPPPPVEVIMPSPVYNQPVVVVEQP
SYNQPGPPQGPSDAECCMLLGACCVMEECGLCVIM*

IP03601.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:19:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13171-PA 83 GF13171-PA 1..82 1..84 252 82.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:19:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20895-PA 85 GG20895-PA 1..85 1..85 381 90.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 17:19:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22766-PA 85 GH22766-PA 1..80 1..78 140 47.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:24:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG15127-PA 85 CG15127-PA 1..85 1..85 476 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:19:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18543-PA 76 GI18543-PA 1..76 1..85 184 54 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:19:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11727-PA 86 GL11727-PA 3..85 2..84 283 72.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:19:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13515-PA 86 GA13515-PA 3..85 2..84 288 72.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:19:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19818-PA 85 GM19818-PA 1..85 1..85 409 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:19:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25310-PA 85 GD25310-PA 1..85 1..85 409 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:19:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21413-PA 77 GJ21413-PA 1..76 1..84 193 54.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:19:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15886-PA 70 GK15886-PA 1..50 1..48 129 70 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:19:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13834-PA 85 GE13834-PA 1..85 1..85 398 97.6 Plus

IP03601.hyp Sequence

Translation from 97 to 354

> IP03601.hyp
MYNAGYQVDVIDPYYQPPVEVVNVIGPPPPVEVIMPSPVYNQPVVVVEQP
SYNQPGPPQGPSDAECCMLLGACCVMEECGLCVIM*

IP03601.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:04:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG15127-PA 85 CG15127-PA 1..85 1..85 476 100 Plus