Clone IP03603 Report

Search the DGRC for IP03603

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:36
Well:3
Vector:pOT2
Associated Gene/TranscriptCheB42a-RA
Protein status:IP03603.pep: gold
Preliminary Size:1797
Sequenced Size:870

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CheB42a 2008-04-29 Release 5.5 accounting
CheB42a 2008-08-15 Release 5.9 accounting
CheB42a 2008-12-18 5.12 accounting

Clone Sequence Records

IP03603.complete Sequence

870 bp (870 high quality bases) assembled on 2005-08-25

GenBank Submission: BT023863

> IP03603.complete
AGATACGCCCTTTTTAAATTATTAAAGACAATGATTTTATCATATCATAA
TCATATTATACTGTGTGCAATTAGAATCATAGACGACCCCTAAGCTGTAT
ATAACGTGCAGTTTTTAGCACTATGTACCCATCCTCATACTGGAAAGCTT
GTTAATATGAAGGCTACTTTTACAATCCTGGTGCTCCAAGTGGTCATCTG
TTTGGCTGGAGCGACTGAGTACCAGTTAACATTGGACAAAGATGGCTTGT
TAGCACCATGCGAGAATCAGCCCGGAAATCCTTCTGGTTTTGAAGCGATG
GTGGATACTTCCTCCCTTAAAGTACATAACCTTGGTTCGAAAGTTCGAAT
TGAAGGAGAGCAGAAAGTGGTCTGGAAAGATGTCCAGCCTGGAGACACAT
TAAAGGTATTTGGTCAAGTCTATCGCCTGGATAAGGGCACTTGGCAGAAG
ACTATGTTTACGGCCAGCTCCAATAACTTTTGCAAAAACATGTTTGATAA
GAACCAATACTGGTATAATTTCTGGACAAAGTATATTAGCAACTCCGACG
AGATTAAGGAAAAGTGCTTGACCACACCAGGGGCCGTTTTAAAGTACAAA
GACTACGAACTGGACTTGAAGACCAGCTTGAATGTTCCGAATCTGGATGG
GCGCTACAAGCTGGTGGTCCAAATAGAGGCCTTCGATAAGCGCAATGTAA
GGCGCCCAGTTCCCATTTGCATAGAGTTCCGTGGAACTGCAGGACAGGTC
TAATCACGACAATTGTATATGCATGCTGAACATACAGCGAAACACCATTA
AAGTCTATAATTGGAGCACATCAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAA

IP03603.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:29:45
Subject Length Description Subject Range Query Range Score Percent Strand
CheB42a-RA 907 CheB42a-RA 1..825 1..825 4125 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 09:48:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 2836734..2837139 1..406 2015 99.8 Plus
chr2R 21145070 chr2R 2837426..2837666 582..822 1205 100 Plus
chr2R 21145070 chr2R 2837187..2837366 404..583 900 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:38:34 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 09:48:13
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6949349..6949754 1..406 2030 100 Plus
2R 25286936 2R 6950040..6950283 582..825 1220 100 Plus
2R 25286936 2R 6949802..6949981 404..583 900 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:20:47
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 6950548..6950953 1..406 2030 100 Plus
2R 25260384 2R 6951239..6951482 582..825 1220 100 Plus
2R 25260384 2R 6951001..6951180 404..583 900 100 Plus
Blast to na_te.dros performed on 2019-03-16 09:48:14 has no hits.

IP03603.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 09:48:55 Download gff for IP03603.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 2836734..2837138 1..405 99 -> Plus
chr2R 2837189..2837365 406..582 100 -> Plus
chr2R 2837427..2837666 583..822 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:20:57 Download gff for IP03603.complete
Subject Subject Range Query Range Percent Splice Strand
CheB42a-RA 1..597 157..753 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:52:25 Download gff for IP03603.complete
Subject Subject Range Query Range Percent Splice Strand
CheB42a-RA 1..597 157..753 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:42:49 Download gff for IP03603.complete
Subject Subject Range Query Range Percent Splice Strand
CheB42a-RA 1..597 157..753 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:33:08 Download gff for IP03603.complete
Subject Subject Range Query Range Percent Splice Strand
CheB42a-RA 1..597 157..753 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:20:59 Download gff for IP03603.complete
Subject Subject Range Query Range Percent Splice Strand
CheB42a-RA 1..597 157..753 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:26:54 Download gff for IP03603.complete
Subject Subject Range Query Range Percent Splice Strand
CheB42a-RA 1..689 134..822 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:52:24 Download gff for IP03603.complete
Subject Subject Range Query Range Percent Splice Strand
CheB42a-RA 1..822 1..822 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:42:49 Download gff for IP03603.complete
Subject Subject Range Query Range Percent Splice Strand
CheB42a-RA 1..689 134..822 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:33:08 Download gff for IP03603.complete
Subject Subject Range Query Range Percent Splice Strand
CheB42a-RA 1..689 134..822 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:20:59 Download gff for IP03603.complete
Subject Subject Range Query Range Percent Splice Strand
CheB42a-RA 1..689 134..822 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:48:55 Download gff for IP03603.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6949349..6949753 1..405 100 -> Plus
2R 6949804..6949980 406..582 100 -> Plus
2R 6950041..6950280 583..822 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:48:55 Download gff for IP03603.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6949349..6949753 1..405 100 -> Plus
2R 6949804..6949980 406..582 100 -> Plus
2R 6950041..6950280 583..822 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 09:48:55 Download gff for IP03603.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6949349..6949753 1..405 100 -> Plus
2R 6949804..6949980 406..582 100 -> Plus
2R 6950041..6950280 583..822 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:42:49 Download gff for IP03603.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2836854..2837258 1..405 100 -> Plus
arm_2R 2837309..2837485 406..582 100 -> Plus
arm_2R 2837546..2837785 583..822 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:11:40 Download gff for IP03603.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6951003..6951179 406..582 100 -> Plus
2R 6951240..6951479 583..822 100   Plus
2R 6950548..6950952 1..405 100 -> Plus

IP03603.pep Sequence

Translation from 156 to 752

> IP03603.pep
MKATFTILVLQVVICLAGATEYQLTLDKDGLLAPCENQPGNPSGFEAMVD
TSSLKVHNLGSKVRIEGEQKVVWKDVQPGDTLKVFGQVYRLDKGTWQKTM
FTASSNNFCKNMFDKNQYWYNFWTKYISNSDEIKEKCLTTPGAVLKYKDY
ELDLKTSLNVPNLDGRYKLVVQIEAFDKRNVRRPVPICIEFRGTAGQV*

IP03603.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 14:11:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13150-PA 200 GF13150-PA 20..195 19..193 572 58 Plus
Dana\GF11760-PA 198 GF11760-PA 2..192 1..193 370 35.1 Plus
Dana\GF11757-PA 196 GF11757-PA 8..191 12..193 331 33.5 Plus
Dana\GF19949-PA 204 GF19949-PA 19..201 14..198 323 33 Plus
Dana\GF19882-PA 257 GF19882-PA 2..252 3..192 203 24.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 14:11:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23235-PA 198 GG23235-PA 1..198 1..198 904 82.8 Plus
Dere\GG10786-PA 196 GG10786-PA 3..192 6..195 352 35.6 Plus
Dere\GG10785-PA 196 GG10785-PA 3..195 6..198 349 33.5 Plus
Dere\GG21547-PA 197 GG21547-PA 4..196 6..198 345 35.6 Plus
Dere\GG11614-PA 198 GG11614-PA 5..191 7..198 328 35.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 14:11:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19860-PA 198 GH19860-PA 2..193 5..193 342 34 Plus
Dgri\GH11359-PA 200 GH11359-PA 6..195 2..193 327 32.3 Plus
Dgri\GH11360-PA 193 GH11360-PA 2..193 5..198 311 31.4 Plus
Dgri\GH19861-PA 1785 GH19861-PA 17..195 19..193 299 32.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:25
Subject Length Description Subject Range Query Range Score Percent Strand
CheB42a-PA 198 CG33348-PA 1..198 1..198 1053 100 Plus
CheB42b-PA 196 CG33351-PA 4..190 7..193 363 35.6 Plus
CheB38b-PA 197 CG33321-PA 5..196 7..198 351 34.7 Plus
CheB42c-PB 196 CG33350-PB 3..195 6..198 333 33.5 Plus
CheB53b-PA 204 CG33524-PA 11..196 7..193 316 32.1 Plus
CheB98a-PB 197 CG14531-PB 1..190 1..193 305 32.1 Plus
CheB74a-PA 202 CG33924-PA 1..196 1..193 297 32.8 Plus
CheB38a-PA 197 CG33320-PA 7..196 9..198 287 31.9 Plus
CheB38c-PA 198 CG14405-PA 1..196 1..198 285 32.5 Plus
CheB93a-PA 200 CG15503-PA 10..195 6..193 284 33.5 Plus
CheB93b-PA 203 CG31438-PA 33..198 27..193 272 33.9 Plus
CheB53a-PA 226 CG33550-PA 5..189 7..193 272 28.3 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 14:11:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19808-PA 199 GI19808-PA 15..194 15..193 340 34.3 Plus
Dmoj\GI24073-PA 201 GI24073-PA 6..195 2..193 337 32.3 Plus
Dmoj\GI24062-PA 146 GI24062-PA 1..140 48..193 245 34.2 Plus
Dmoj\GI18506-PA 196 GI18506-PA 1..196 1..198 235 24.7 Plus
Dmoj\GI23608-PA 200 GI23608-PA 5..200 1..198 233 24.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 14:11:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11129-PA 202 GL11129-PA 6..202 2..198 619 55.1 Plus
Dper\GL10962-PA 197 GL10962-PA 4..196 8..198 340 35.4 Plus
Dper\GL27150-PA 201 GL27150-PA 7..196 3..193 333 30.9 Plus
Dper\GL13801-PA 200 GL13801-PA 10..195 6..193 332 36.2 Plus
Dper\GL27336-PA 199 GL27336-PA 24..193 22..193 277 32.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 14:11:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24619-PA 202 GA24619-PA 6..202 2..198 618 55.1 Plus
Dpse\GA24546-PA 197 GA24546-PA 4..196 8..198 340 35.4 Plus
Dpse\GA13057-PA 200 GA13057-PA 11..195 8..193 332 34.4 Plus
Dpse\GA16252-PA 201 GA16252-PA 7..196 3..193 327 30.4 Plus
Dpse\GA27041-PA 199 GA27041-PA 24..193 22..193 271 32.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 14:11:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20908-PA 198 GM20908-PA 1..198 1..198 990 92.4 Plus
Dsec\GM20836-PA 196 GM20836-PA 4..190 7..193 373 36.2 Plus
Dsec\GM20835-PA 196 GM20835-PA 3..195 6..198 354 34 Plus
Dsec\GM23304-PA 197 GM23304-PA 4..196 6..198 331 33.5 Plus
Dsec\GM24315-PA 202 GM24315-PA 1..196 1..193 318 33.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 14:11:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10436-PA 190 GD10436-PA 1..190 1..198 964 89.9 Plus
Dsim\GD10289-PA 196 GD10289-PA 4..190 7..193 374 36.2 Plus
Dsim\GD10288-PA 196 GD10288-PA 3..195 6..198 350 34 Plus
Dsim\GD21678-PA 197 GD21678-PA 4..196 6..198 332 34 Plus
Dsim\GD12386-PA 202 GD12386-PA 1..196 1..193 305 32.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 14:11:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18474-PA 199 GJ18474-PA 1..194 1..193 372 34.4 Plus
Dvir\GJ23997-PA 200 GJ23997-PA 6..195 2..193 307 30.7 Plus
Dvir\GJ23996-PA 200 GJ23996-PA 6..195 2..193 301 29.2 Plus
Dvir\GJ23975-PA 200 GJ23975-PA 11..195 7..193 298 32.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 14:11:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21541-PA 201 GK21541-PA 7..192 5..193 345 34.7 Plus
Dwil\GK21768-PA 205 GK21768-PA 15..205 13..198 340 36.6 Plus
Dwil\GK12101-PA 208 GK12101-PA 9..197 7..195 325 33.5 Plus
Dwil\GK10987-PA 200 GK10987-PA 7..196 3..192 260 30.1 Plus
Dwil\GK18906-PA 203 GK18906-PA 4..190 6..189 241 30.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 14:11:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19086-PA 197 GE19086-PA 1..197 1..198 883 80.3 Plus
Dyak\GE24356-PA 196 GE24356-PA 3..190 5..193 366 39.8 Plus
Dyak\GE24346-PA 196 GE24346-PA 3..195 6..198 357 35.6 Plus
Dyak\GE13541-PA 197 GE13541-PA 4..196 6..198 344 34 Plus
Dyak\GE11795-PA 206 GE11795-PA 11..196 7..193 322 31.6 Plus

IP03603.hyp Sequence

Translation from 156 to 752

> IP03603.hyp
MKATFTILVLQVVICLAGATEYQLTLDKDGLLAPCENQPGNPSGFEAMVD
TSSLKVHNLGSKVRIEGEQKVVWKDVQPGDTLKVFGQVYRLDKGTWQKTM
FTASSNNFCKNMFDKNQYWYNFWTKYISNSDEIKEKCLTTPGAVLKYKDY
ELDLKTSLNVPNLDGRYKLVVQIEAFDKRNVRRPVPICIEFRGTAGQV*

IP03603.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:04:26
Subject Length Description Subject Range Query Range Score Percent Strand
CheB42a-PA 198 CG33348-PA 1..198 1..198 1053 100 Plus
CheB42b-PA 196 CG33351-PA 4..190 7..193 363 35.6 Plus
CheB38b-PA 197 CG33321-PA 5..196 7..198 351 34.7 Plus
CheB42c-PB 196 CG33350-PB 3..195 6..198 333 33.5 Plus
CheB53b-PA 204 CG33524-PA 11..196 7..193 316 32.1 Plus