IP03615.complete Sequence
434 bp (434 high quality bases) assembled on 2004-12-17
GenBank Submission: BT023693
> IP03615.complete
CCAGCCGTTGAGTCAGTAACAAAATTTTTCTATACTTTTACATTTGGTTT
CCCAAAAAAAAAAAAAAATCACAAAAAAAAACGACAAAAAAATTAAACAT
GGCCGACATCTTCACGACACTGCCGAAACGTCGGTTGGTACCCAACCTAC
TTAAGTCCATTATAATGGTCCTGGAGCATACTAGCCGACCCATGACTGAC
ACAGAGCTGAACATCTTCCTGGGCAGCCAGTACCAACGTAACGATCCGGA
ATTCTTTGCCCAAGTGCAAATCAATCTGCACGATGGCATCGAAAGCGCCA
TTCTGAGGCGCCAGGGAAACCAGATTTCGCTGCTCGCTTGGATCCTCACC
AAACCGATGAACCTTTGAAAACCGCCAAACCCACACTTCAGATAAGAAGA
ATAATCCTTAACAGAAAAAAAAAAAAAAAAAAAA
IP03615.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:50:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15578-RA | 415 | CG15578-RA | 1..415 | 1..414 | 2035 | 99.7 | Plus |
CG15577-RA | 508 | CG15577-RA | 139..338 | 134..333 | 475 | 82.5 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:55:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chrX | 22417052 | chrX | 4170606..4171021 | 414..1 | 1965 | 99.3 | Minus |
chrX | 22417052 | chrX | 4169722..4169921 | 333..134 | 475 | 82.5 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:38:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:55:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 4277545..4277961 | 416..1 | 2035 | 99.8 | Minus |
X | 23542271 | X | 4276663..4276862 | 333..134 | 475 | 82.5 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:39:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23527363 | X | 4285643..4286059 | 416..1 | 2045 | 99.7 | Minus |
X | 23527363 | X | 4284761..4284960 | 333..134 | 475 | 82.5 | Minus |
Blast to na_te.dros performed on 2019-03-16 16:55:15 has no hits.
IP03615.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed on 2019-03-16 16:56:01 has no hits.
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:21:03 Download gff for
IP03615.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15578-RA | 1..270 | 99..368 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:21:21 Download gff for
IP03615.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15578-RA | 1..270 | 99..368 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:49:14 Download gff for
IP03615.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15578-RA | 1..270 | 99..368 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:05:18 Download gff for
IP03615.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15578-RA | 1..270 | 99..368 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:47:30 Download gff for
IP03615.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15578-RA | 1..270 | 99..368 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:22:08 Download gff for
IP03615.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15578-RA | 1..270 | 99..368 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:21:21 Download gff for
IP03615.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15578-RA | 1..415 | 1..414 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:49:14 Download gff for
IP03615.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15578-RA | 1..415 | 1..414 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:05:18 Download gff for
IP03615.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15578-RA | 1..270 | 99..368 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:47:30 Download gff for
IP03615.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15578-RA | 1..415 | 1..414 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:56:01 Download gff for
IP03615.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 4277547..4277961 | 1..414 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:56:01 Download gff for
IP03615.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 4277547..4277961 | 1..414 | 99 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:56:01 Download gff for
IP03615.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 4277547..4277961 | 1..414 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:49:14 Download gff for
IP03615.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 4171580..4171994 | 1..414 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:41:39 Download gff for
IP03615.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 4285645..4286059 | 1..414 | 99 | | Minus |
IP03615.hyp Sequence
Translation from 0 to 367
> IP03615.hyp
PAVESVTKFFYTFTFGFPKKKKKSQKKTTKKLNMADIFTTLPKRRLVPNL
LKSIIMVLEHTSRPMTDTELNIFLGSQYQRNDPEFFAQVQINLHDGIESA
ILRRQGNQISLLAWILTKPMNL*
IP03615.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:04:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15578-PA | 89 | CG15578-PA | 1..89 | 34..122 | 452 | 100 | Plus |
CG15577-PA | 99 | CG15577-PA | 9..81 | 40..111 | 254 | 68.5 | Plus |
IP03615.pep Sequence
Translation from 98 to 367
> IP03615.pep
MADIFTTLPKRRLVPNLLKSIIMVLEHTSRPMTDTELNIFLGSQYQRNDP
EFFAQVQINLHDGIESAILRRQGNQISLLAWILTKPMNL*
IP03615.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:45:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF21481-PA | 100 | GF21481-PA | 9..90 | 7..87 | 202 | 53.7 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:45:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG18551-PA | 99 | GG18551-PA | 9..91 | 7..88 | 240 | 59 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15578-PA | 89 | CG15578-PA | 1..89 | 1..89 | 452 | 100 | Plus |
CG15577-PA | 99 | CG15577-PA | 9..81 | 7..78 | 254 | 68.5 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:45:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI16135-PA | 102 | GI16135-PA | 13..87 | 10..84 | 152 | 44 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:45:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL14189-PA | 92 | GL14189-PA | 4..79 | 10..85 | 196 | 51.3 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:45:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA13823-PA | 101 | GA13823-PA | 6..88 | 3..85 | 200 | 49.4 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:45:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM12697-PA | 99 | GM12697-PA | 9..88 | 7..85 | 269 | 65 | Plus |
Dsec\GM12696-PA | 85 | GM12696-PA | 4..77 | 16..89 | 210 | 52.7 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:45:56
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD24601-PA | 99 | GD24601-PA | 9..86 | 7..83 | 267 | 66.7 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:45:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK17523-PA | 99 | GK17523-PA | 9..99 | 7..88 | 183 | 45.1 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:45:58
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE16864-PA | 99 | GE16864-PA | 9..91 | 7..88 | 243 | 60.2 | Plus |