Clone IP03615 Report

Search the DGRC for IP03615

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:36
Well:15
Vector:pOT2
Associated Gene/TranscriptCG15578-RA
Protein status:IP03615.pep: gold
Preliminary Size:270
Sequenced Size:434

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15578 2005-01-01 Successful iPCR screen
CG15578 2008-04-29 Release 5.5 accounting
CG15578 2008-08-15 Release 5.9 accounting
CG15578 2008-12-18 5.12 accounting

Clone Sequence Records

IP03615.complete Sequence

434 bp (434 high quality bases) assembled on 2004-12-17

GenBank Submission: BT023693

> IP03615.complete
CCAGCCGTTGAGTCAGTAACAAAATTTTTCTATACTTTTACATTTGGTTT
CCCAAAAAAAAAAAAAAATCACAAAAAAAAACGACAAAAAAATTAAACAT
GGCCGACATCTTCACGACACTGCCGAAACGTCGGTTGGTACCCAACCTAC
TTAAGTCCATTATAATGGTCCTGGAGCATACTAGCCGACCCATGACTGAC
ACAGAGCTGAACATCTTCCTGGGCAGCCAGTACCAACGTAACGATCCGGA
ATTCTTTGCCCAAGTGCAAATCAATCTGCACGATGGCATCGAAAGCGCCA
TTCTGAGGCGCCAGGGAAACCAGATTTCGCTGCTCGCTTGGATCCTCACC
AAACCGATGAACCTTTGAAAACCGCCAAACCCACACTTCAGATAAGAAGA
ATAATCCTTAACAGAAAAAAAAAAAAAAAAAAAA

IP03615.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:50:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG15578-RA 415 CG15578-RA 1..415 1..414 2035 99.7 Plus
CG15577-RA 508 CG15577-RA 139..338 134..333 475 82.5 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 16:55:16
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 4170606..4171021 414..1 1965 99.3 Minus
chrX 22417052 chrX 4169722..4169921 333..134 475 82.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:38:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 16:55:14
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4277545..4277961 416..1 2035 99.8 Minus
X 23542271 X 4276663..4276862 333..134 475 82.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:39:40
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 4285643..4286059 416..1 2045 99.7 Minus
X 23527363 X 4284761..4284960 333..134 475 82.5 Minus
Blast to na_te.dros performed on 2019-03-16 16:55:15 has no hits.

IP03615.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed on 2019-03-16 16:56:01 has no hits.
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:21:03 Download gff for IP03615.complete
Subject Subject Range Query Range Percent Splice Strand
CG15578-RA 1..270 99..368 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:21:21 Download gff for IP03615.complete
Subject Subject Range Query Range Percent Splice Strand
CG15578-RA 1..270 99..368 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 16:49:14 Download gff for IP03615.complete
Subject Subject Range Query Range Percent Splice Strand
CG15578-RA 1..270 99..368 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:05:18 Download gff for IP03615.complete
Subject Subject Range Query Range Percent Splice Strand
CG15578-RA 1..270 99..368 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 12:47:30 Download gff for IP03615.complete
Subject Subject Range Query Range Percent Splice Strand
CG15578-RA 1..270 99..368 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:22:08 Download gff for IP03615.complete
Subject Subject Range Query Range Percent Splice Strand
CG15578-RA 1..270 99..368 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:21:21 Download gff for IP03615.complete
Subject Subject Range Query Range Percent Splice Strand
CG15578-RA 1..415 1..414 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 16:49:14 Download gff for IP03615.complete
Subject Subject Range Query Range Percent Splice Strand
CG15578-RA 1..415 1..414 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:05:18 Download gff for IP03615.complete
Subject Subject Range Query Range Percent Splice Strand
CG15578-RA 1..270 99..368 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 12:47:30 Download gff for IP03615.complete
Subject Subject Range Query Range Percent Splice Strand
CG15578-RA 1..415 1..414 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:56:01 Download gff for IP03615.complete
Subject Subject Range Query Range Percent Splice Strand
X 4277547..4277961 1..414 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:56:01 Download gff for IP03615.complete
Subject Subject Range Query Range Percent Splice Strand
X 4277547..4277961 1..414 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 16:56:01 Download gff for IP03615.complete
Subject Subject Range Query Range Percent Splice Strand
X 4277547..4277961 1..414 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 16:49:14 Download gff for IP03615.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 4171580..4171994 1..414 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:41:39 Download gff for IP03615.complete
Subject Subject Range Query Range Percent Splice Strand
X 4285645..4286059 1..414 99   Minus

IP03615.hyp Sequence

Translation from 0 to 367

> IP03615.hyp
PAVESVTKFFYTFTFGFPKKKKKSQKKTTKKLNMADIFTTLPKRRLVPNL
LKSIIMVLEHTSRPMTDTELNIFLGSQYQRNDPEFFAQVQINLHDGIESA
ILRRQGNQISLLAWILTKPMNL*

IP03615.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:04:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG15578-PA 89 CG15578-PA 1..89 34..122 452 100 Plus
CG15577-PA 99 CG15577-PA 9..81 40..111 254 68.5 Plus

IP03615.pep Sequence

Translation from 98 to 367

> IP03615.pep
MADIFTTLPKRRLVPNLLKSIIMVLEHTSRPMTDTELNIFLGSQYQRNDP
EFFAQVQINLHDGIESAILRRQGNQISLLAWILTKPMNL*

IP03615.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:45:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21481-PA 100 GF21481-PA 9..90 7..87 202 53.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:45:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18551-PA 99 GG18551-PA 9..91 7..88 240 59 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:37:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG15578-PA 89 CG15578-PA 1..89 1..89 452 100 Plus
CG15577-PA 99 CG15577-PA 9..81 7..78 254 68.5 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:45:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16135-PA 102 GI16135-PA 13..87 10..84 152 44 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:45:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14189-PA 92 GL14189-PA 4..79 10..85 196 51.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:45:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13823-PA 101 GA13823-PA 6..88 3..85 200 49.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:45:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12697-PA 99 GM12697-PA 9..88 7..85 269 65 Plus
Dsec\GM12696-PA 85 GM12696-PA 4..77 16..89 210 52.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:45:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24601-PA 99 GD24601-PA 9..86 7..83 267 66.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:45:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17523-PA 99 GK17523-PA 9..99 7..88 183 45.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:45:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16864-PA 99 GE16864-PA 9..91 7..88 243 60.2 Plus