Clone IP03616 Report

Search the DGRC for IP03616

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:36
Well:16
Vector:pOT2
Associated Gene/TranscriptCG15579-RA
Protein status:IP03616.pep: gold
Preliminary Size:285
Sequenced Size:456

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15579 2005-01-01 Successful iPCR screen
CG15579 2008-04-29 Release 5.5 accounting
CG15579 2008-08-15 Release 5.9 accounting
CG15579 2008-12-18 5.12 accounting

Clone Sequence Records

IP03616.complete Sequence

456 bp (456 high quality bases) assembled on 2004-12-17

GenBank Submission: BT023694

> IP03616.complete
ACCTTGTTCAATTAACTCCAACCAAACAGATACGACAGATTTACTCTCTT
AAATTCTATTTTCACCAAGCATTTCCCTTGGAATTTTGTTGTGGCAATGG
CGCGTTACCTGTACGCTGACCACATTTTGGAGGCCTTCAACGTATTCCAT
CGTCCACTCAACCTGGACGAGGTGGCTTCGTATGTGGCCGAAATGGAGGC
CAAGACTGTTGACGAGGTGCGACTGGCGGTGGATAACACGCTGACCGCCG
GCTGGATGCACGGTTTCCTGGCCATTGAGGACGGGCTGTTCACGCTGGCC
TGCGGCTACTGGGACGAGACGCAGCCGAGCGGCGGCAAGAAAGGGAGACG
CCACACAGCGAAAGCAATGCTAAGGAGTTAATAGTGAATCTATTAGAATC
AAAAATCGTGTCGCTCTACCATGGTGTGGGCTTTGCAAAAAAAAAAAAAA
AAAAAA

IP03616.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:50:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG15579-RA 436 CG15579-RA 1..436 1..436 2180 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:12:41
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 4204443..4204878 436..1 2135 99.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:38:43 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:12:39
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4311344..4311799 456..1 2280 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:39:41
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 4319442..4319897 456..1 2280 100 Minus
Blast to na_te.dros performed on 2019-03-16 19:12:39 has no hits.

IP03616.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:13:28 Download gff for IP03616.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 4204443..4204878 1..436 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:21:04 Download gff for IP03616.complete
Subject Subject Range Query Range Percent Splice Strand
CG15579-RA 1..285 97..381 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:21:22 Download gff for IP03616.complete
Subject Subject Range Query Range Percent Splice Strand
CG15579-RA 1..285 97..381 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:33:23 Download gff for IP03616.complete
Subject Subject Range Query Range Percent Splice Strand
CG15579-RA 1..285 97..381 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:05:19 Download gff for IP03616.complete
Subject Subject Range Query Range Percent Splice Strand
CG15579-RA 1..285 97..381 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 14:02:54 Download gff for IP03616.complete
Subject Subject Range Query Range Percent Splice Strand
CG15579-RA 1..285 97..381 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:22:10 Download gff for IP03616.complete
Subject Subject Range Query Range Percent Splice Strand
CG15579-RA 1..436 1..436 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:21:22 Download gff for IP03616.complete
Subject Subject Range Query Range Percent Splice Strand
CG15579-RA 1..436 1..436 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:33:23 Download gff for IP03616.complete
Subject Subject Range Query Range Percent Splice Strand
CG15579-RA 1..436 1..436 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:05:19 Download gff for IP03616.complete
Subject Subject Range Query Range Percent Splice Strand
CG15579-RA 1..285 97..381 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 14:02:54 Download gff for IP03616.complete
Subject Subject Range Query Range Percent Splice Strand
CG15579-RA 1..436 1..436 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:13:28 Download gff for IP03616.complete
Subject Subject Range Query Range Percent Splice Strand
X 4311364..4311799 1..436 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:13:28 Download gff for IP03616.complete
Subject Subject Range Query Range Percent Splice Strand
X 4311364..4311799 1..436 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:13:28 Download gff for IP03616.complete
Subject Subject Range Query Range Percent Splice Strand
X 4311364..4311799 1..436 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:33:23 Download gff for IP03616.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 4205397..4205832 1..436 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:41:40 Download gff for IP03616.complete
Subject Subject Range Query Range Percent Splice Strand
X 4319462..4319897 1..436 100   Minus

IP03616.pep Sequence

Translation from 96 to 380

> IP03616.pep
MARYLYADHILEAFNVFHRPLNLDEVASYVAEMEAKTVDEVRLAVDNTLT
AGWMHGFLAIEDGLFTLACGYWDETQPSGGKKGRRHTAKAMLRS*

IP03616.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:46:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20791-PA 96 GF20791-PA 1..91 1..90 339 67 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:46:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18548-PA 91 GG18548-PA 1..90 1..94 382 76.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:46:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24670-PA 83 GH24670-PA 1..68 1..68 201 54.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:18:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG15579-PB 94 CG15579-PB 1..94 1..94 497 100 Plus
CG15579-PA 94 CG15579-PA 1..94 1..94 497 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:46:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16409-PA 114 GI16409-PA 1..67 1..67 203 56.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:46:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL20176-PA 229 GL20176-PA 1..86 1..93 301 61.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:46:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26743-PA 197 GA26743-PA 1..79 1..79 294 64.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:46:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12693-PA 94 GM12693-PA 1..94 1..94 480 95.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:46:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD16303-PA 94 GD16303-PA 1..94 1..94 487 96.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:46:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16411-PA 95 GJ16411-PA 1..84 1..87 215 50.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:46:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15648-PA 68 GK15648-PA 1..67 1..67 244 70.1 Plus
Dwil\GK15659-PA 92 GK15659-PA 10..74 6..70 131 44.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:46:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14726-PA 95 GE14726-PA 1..94 1..94 455 88.3 Plus

IP03616.hyp Sequence

Translation from 96 to 380

> IP03616.hyp
MARYLYADHILEAFNVFHRPLNLDEVASYVAEMEAKTVDEVRLAVDNTLT
AGWMHGFLAIEDGLFTLACGYWDETQPSGGKKGRRHTAKAMLRS*

IP03616.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:04:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG15579-PB 94 CG15579-PB 1..94 1..94 497 100 Plus
CG15579-PA 94 CG15579-PA 1..94 1..94 497 100 Plus