Clone IP03664 Report

Search the DGRC for IP03664

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:36
Well:64
Vector:pOT2
Associated Gene/TranscriptCG31704-RA
Protein status:IP03664.pep: gold
Preliminary Size:207
Sequenced Size:302

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31704 2005-01-01 Successful iPCR screen
CG31704 2008-04-29 Release 5.5 accounting
CG31704 2008-08-15 Release 5.9 accounting
CG31704 2008-12-18 5.12 accounting

Clone Sequence Records

IP03664.complete Sequence

302 bp (302 high quality bases) assembled on 2004-12-17

GenBank Submission: BT023691

> IP03664.complete
ATGCGTTGCCTAGCCTTCATCGCTTTCTGTCTGTCTGCTCTTTTGGCCAT
GGCTGTGGGCCAGGTATTCCAGTACTCCTGCCCGTGTCCTCGAAACTATG
ATCCTGTGTGCGGATCGGACTCCGTGACCTATAGTAACCAGTGTGTTTTG
GATTGTTTAATTAAAGAAGGACGCTCCATTACCGTGGAGAAGAAGGGAAG
ATGCTAGAAAACTGAACATGGATCGCCAACTGGTTATCGACTTACATTCG
TATGATAAAAAATGAACAATAAATAATATGTATAAATAAAAAAAAAAAAA
AA

IP03664.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:50:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG31704-RA 322 CG31704-RA 22..310 1..289 1445 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:18:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 11839388..11839674 1..287 1435 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:38:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:18:26
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11840712..11841000 1..289 1445 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:39:41
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11840712..11841000 1..289 1445 100 Plus
Blast to na_te.dros performed on 2019-03-16 06:18:27 has no hits.

IP03664.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:19:10 Download gff for IP03664.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 11839388..11839654 1..267 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:21:17 Download gff for IP03664.complete
Subject Subject Range Query Range Percent Splice Strand
CG31704-RA 1..207 1..207 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:21:23 Download gff for IP03664.complete
Subject Subject Range Query Range Percent Splice Strand
CG31704-RA 1..207 1..207 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:27:02 Download gff for IP03664.complete
Subject Subject Range Query Range Percent Splice Strand
CG31704-RA 1..207 1..207 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:05:20 Download gff for IP03664.complete
Subject Subject Range Query Range Percent Splice Strand
CG31704-RA 1..207 1..207 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:20:30 Download gff for IP03664.complete
Subject Subject Range Query Range Percent Splice Strand
CG31704-RA 1..207 1..207 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:22:11 Download gff for IP03664.complete
Subject Subject Range Query Range Percent Splice Strand
CG31704-RA 22..308 1..287 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:21:23 Download gff for IP03664.complete
Subject Subject Range Query Range Percent Splice Strand
CG31704-RA 22..308 1..287 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:27:02 Download gff for IP03664.complete
Subject Subject Range Query Range Percent Splice Strand
CG31704-RA 22..308 1..287 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:05:20 Download gff for IP03664.complete
Subject Subject Range Query Range Percent Splice Strand
CG31704-RA 1..207 1..207 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:20:30 Download gff for IP03664.complete
Subject Subject Range Query Range Percent Splice Strand
CG31704-RA 22..308 1..287 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:19:10 Download gff for IP03664.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11840712..11840998 1..287 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:19:10 Download gff for IP03664.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11840712..11840998 1..287 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:19:10 Download gff for IP03664.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11840712..11840998 1..287 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:27:02 Download gff for IP03664.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11840712..11840998 1..287 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:41:41 Download gff for IP03664.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11840712..11840998 1..287 100   Plus

IP03664.pep Sequence

Translation from 0 to 206

> IP03664.pep
MRCLAFIAFCLSALLAMAVGQVFQYSCPCPRNYDPVCGSDSVTYSNQCVL
DCLIKEGRSITVEKKGRC*

IP03664.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:46:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23738-PA 67 GG23738-PA 1..67 1..68 172 52.9 Plus
Dere\GG23737-PA 67 GG23737-PA 1..67 1..68 170 52.9 Plus
Dere\GG10293-PA 79 GG10293-PA 34..79 27..68 125 52.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:46:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13067-PA 78 GH13067-PA 7..78 6..68 130 40.5 Plus
Dgri\GH13809-PA 71 GH13809-PA 1..71 1..68 127 44.4 Plus
Dgri\GH13808-PA 71 GH13808-PA 1..71 1..68 125 43.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG31704-PB 68 CG31704-PB 1..68 1..68 370 100 Plus
CG31704-PA 68 CG31704-PA 1..68 1..68 370 100 Plus
CG45011-PB 67 CG45011-PB 6..67 6..68 160 52.4 Plus
CG45011-PA 67 CG45011-PA 6..67 6..68 160 52.4 Plus
Sfp33A3-PA 99 CG42474-PA 1..65 1..68 153 50 Plus
CG44008-PA 79 CG44008-PA 8..79 7..68 144 41.9 Plus
CG44008-PB 79 CG44008-PB 8..79 7..68 144 41.9 Plus
CG45012-PA 65 CG45012-PA 1..65 1..68 136 41.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:46:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15365-PA 71 GL15365-PA 1..71 1..68 196 56.9 Plus
Dper\GL15256-PA 85 GL15256-PA 27..85 14..68 141 47.5 Plus
Dper\GL22973-PA 85 GL22973-PA 27..85 14..68 141 47.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:46:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16408-PA 71 GA16408-PA 1..71 1..68 196 56.9 Plus
Dpse\GA16452-PA 85 GA16452-PA 27..85 14..68 139 47.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:46:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26602-PA 68 GM26602-PA 1..68 1..68 318 88.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:46:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23791-PA 68 GD23791-PA 1..68 1..68 306 85.3 Plus
Dsim\GD22151-PA 79 GD22151-PA 13..79 6..68 131 40.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:46:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19042-PA 73 GK19042-PA 28..73 27..68 139 58.7 Plus
Dwil\GK14969-PA 84 GK14969-PA 16..84 4..68 136 40.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:46:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18544-PA 69 GE18544-PA 1..69 1..68 266 76.8 Plus
Dyak\GE18543-PA 68 GE18543-PA 1..68 1..68 163 60.3 Plus
Dyak\GE12632-PA 79 GE12632-PA 13..79 6..68 140 43.3 Plus
Dyak\GE18542-PA 67 GE18542-PA 6..67 6..68 135 46 Plus

IP03664.hyp Sequence

Translation from 1 to 206

> IP03664.hyp
MRCLAFIAFCLSALLAMAVGQVFQYSCPCPRNYDPVCGSDSVTYSNQCVL
DCLIKEGRSITVEKKGRC*

IP03664.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:05:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG31704-PB 68 CG31704-PB 1..68 1..68 370 100 Plus
CG31704-PA 68 CG31704-PA 1..68 1..68 370 100 Plus
CG45011-PB 67 CG45011-PB 6..67 6..68 160 52.4 Plus
CG45011-PA 67 CG45011-PA 6..67 6..68 160 52.4 Plus
Sfp33A3-PA 99 CG42474-PA 1..65 1..68 153 50 Plus