IP03664.complete Sequence
302 bp (302 high quality bases) assembled on 2004-12-17
GenBank Submission: BT023691
> IP03664.complete
ATGCGTTGCCTAGCCTTCATCGCTTTCTGTCTGTCTGCTCTTTTGGCCAT
GGCTGTGGGCCAGGTATTCCAGTACTCCTGCCCGTGTCCTCGAAACTATG
ATCCTGTGTGCGGATCGGACTCCGTGACCTATAGTAACCAGTGTGTTTTG
GATTGTTTAATTAAAGAAGGACGCTCCATTACCGTGGAGAAGAAGGGAAG
ATGCTAGAAAACTGAACATGGATCGCCAACTGGTTATCGACTTACATTCG
TATGATAAAAAATGAACAATAAATAATATGTATAAATAAAAAAAAAAAAA
AA
IP03664.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:50:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31704-RA | 322 | CG31704-RA | 22..310 | 1..289 | 1445 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 06:18:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2L | 23010047 | chr2L | 11839388..11839674 | 1..287 | 1435 | 100 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:38:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 06:18:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 11840712..11841000 | 1..289 | 1445 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:39:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 11840712..11841000 | 1..289 | 1445 | 100 | Plus |
Blast to na_te.dros performed on 2019-03-16 06:18:27 has no hits.
IP03664.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 06:19:10 Download gff for
IP03664.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2L | 11839388..11839654 | 1..267 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:21:17 Download gff for
IP03664.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31704-RA | 1..207 | 1..207 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:21:23 Download gff for
IP03664.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31704-RA | 1..207 | 1..207 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:27:02 Download gff for
IP03664.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31704-RA | 1..207 | 1..207 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:05:20 Download gff for
IP03664.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31704-RA | 1..207 | 1..207 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:20:30 Download gff for
IP03664.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31704-RA | 1..207 | 1..207 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:22:11 Download gff for
IP03664.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31704-RA | 22..308 | 1..287 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:21:23 Download gff for
IP03664.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31704-RA | 22..308 | 1..287 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:27:02 Download gff for
IP03664.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31704-RA | 22..308 | 1..287 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:05:20 Download gff for
IP03664.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31704-RA | 1..207 | 1..207 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:20:30 Download gff for
IP03664.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG31704-RA | 22..308 | 1..287 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:19:10 Download gff for
IP03664.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 11840712..11840998 | 1..287 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:19:10 Download gff for
IP03664.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 11840712..11840998 | 1..287 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 06:19:10 Download gff for
IP03664.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 11840712..11840998 | 1..287 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:27:02 Download gff for
IP03664.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 11840712..11840998 | 1..287 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:41:41 Download gff for
IP03664.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 11840712..11840998 | 1..287 | 100 | | Plus |
IP03664.pep Sequence
Translation from 0 to 206
> IP03664.pep
MRCLAFIAFCLSALLAMAVGQVFQYSCPCPRNYDPVCGSDSVTYSNQCVL
DCLIKEGRSITVEKKGRC*
IP03664.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:46:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG23738-PA | 67 | GG23738-PA | 1..67 | 1..68 | 172 | 52.9 | Plus |
Dere\GG23737-PA | 67 | GG23737-PA | 1..67 | 1..68 | 170 | 52.9 | Plus |
Dere\GG10293-PA | 79 | GG10293-PA | 34..79 | 27..68 | 125 | 52.2 | Plus |
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:46:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH13067-PA | 78 | GH13067-PA | 7..78 | 6..68 | 130 | 40.5 | Plus |
Dgri\GH13809-PA | 71 | GH13809-PA | 1..71 | 1..68 | 127 | 44.4 | Plus |
Dgri\GH13808-PA | 71 | GH13808-PA | 1..71 | 1..68 | 125 | 43.1 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:31:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31704-PB | 68 | CG31704-PB | 1..68 | 1..68 | 370 | 100 | Plus |
CG31704-PA | 68 | CG31704-PA | 1..68 | 1..68 | 370 | 100 | Plus |
CG45011-PB | 67 | CG45011-PB | 6..67 | 6..68 | 160 | 52.4 | Plus |
CG45011-PA | 67 | CG45011-PA | 6..67 | 6..68 | 160 | 52.4 | Plus |
Sfp33A3-PA | 99 | CG42474-PA | 1..65 | 1..68 | 153 | 50 | Plus |
CG44008-PA | 79 | CG44008-PA | 8..79 | 7..68 | 144 | 41.9 | Plus |
CG44008-PB | 79 | CG44008-PB | 8..79 | 7..68 | 144 | 41.9 | Plus |
CG45012-PA | 65 | CG45012-PA | 1..65 | 1..68 | 136 | 41.2 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:46:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL15365-PA | 71 | GL15365-PA | 1..71 | 1..68 | 196 | 56.9 | Plus |
Dper\GL15256-PA | 85 | GL15256-PA | 27..85 | 14..68 | 141 | 47.5 | Plus |
Dper\GL22973-PA | 85 | GL22973-PA | 27..85 | 14..68 | 141 | 47.5 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:46:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA16408-PA | 71 | GA16408-PA | 1..71 | 1..68 | 196 | 56.9 | Plus |
Dpse\GA16452-PA | 85 | GA16452-PA | 27..85 | 14..68 | 139 | 47.5 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:46:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM26602-PA | 68 | GM26602-PA | 1..68 | 1..68 | 318 | 88.2 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:46:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD23791-PA | 68 | GD23791-PA | 1..68 | 1..68 | 306 | 85.3 | Plus |
Dsim\GD22151-PA | 79 | GD22151-PA | 13..79 | 6..68 | 131 | 40.3 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:46:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK19042-PA | 73 | GK19042-PA | 28..73 | 27..68 | 139 | 58.7 | Plus |
Dwil\GK14969-PA | 84 | GK14969-PA | 16..84 | 4..68 | 136 | 40.6 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:46:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE18544-PA | 69 | GE18544-PA | 1..69 | 1..68 | 266 | 76.8 | Plus |
Dyak\GE18543-PA | 68 | GE18543-PA | 1..68 | 1..68 | 163 | 60.3 | Plus |
Dyak\GE12632-PA | 79 | GE12632-PA | 13..79 | 6..68 | 140 | 43.3 | Plus |
Dyak\GE18542-PA | 67 | GE18542-PA | 6..67 | 6..68 | 135 | 46 | Plus |
IP03664.hyp Sequence
Translation from 1 to 206
> IP03664.hyp
MRCLAFIAFCLSALLAMAVGQVFQYSCPCPRNYDPVCGSDSVTYSNQCVL
DCLIKEGRSITVEKKGRC*
IP03664.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:05:36
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG31704-PB | 68 | CG31704-PB | 1..68 | 1..68 | 370 | 100 | Plus |
CG31704-PA | 68 | CG31704-PA | 1..68 | 1..68 | 370 | 100 | Plus |
CG45011-PB | 67 | CG45011-PB | 6..67 | 6..68 | 160 | 52.4 | Plus |
CG45011-PA | 67 | CG45011-PA | 6..67 | 6..68 | 160 | 52.4 | Plus |
Sfp33A3-PA | 99 | CG42474-PA | 1..65 | 1..68 | 153 | 50 | Plus |