Clone IP03739 Report

Search the DGRC for IP03739

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:37
Well:39
Vector:pOT2
Associated Gene/TranscriptCG17776-RA
Protein status:IP03739.pep: gold
Preliminary Size:213
Sequenced Size:403

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17776 2005-01-01 Successful iPCR screen
CG17776 2008-04-29 Release 5.5 accounting
CG17776 2008-08-15 Release 5.9 accounting
CG17776 2008-12-18 5.12 accounting

Clone Sequence Records

IP03739.complete Sequence

403 bp (403 high quality bases) assembled on 2004-12-17

GenBank Submission: BT023692

> IP03739.complete
CTCGTGCCGAATTCGGCACGAGATGGACTTGGAAGGGATTTGCCGCCATG
CAGAAGAAGCCGATTAACACCAACACGCTGCTGGACAAGCTGCACCGCGG
CGCGGTGTATGCCTGCATTGGAGTCACCCTGTACGGCACCTACATCCTGG
GAATGCGCTACTACCACTACTGCACGGTCATCCGACCGGAGAAGCAGCAG
GCGGAGCTGAAGCTCCTGGACGAGGGAGCCCACGACAAGGCCAAGGAACT
GAAGTACTAGGCGCGCCCTCCTCCGCCCCTTTAATTGTTAAATGTCTGTT
AAGCGCAATAAACTGTAAGGAAATGTAAGCATTTTCAGCTGAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
AAA

IP03739.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:50:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG17776-RA 323 CG17776-RA 1..323 23..345 1615 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 05:34:47
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 2078871..2079187 25..341 1585 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:39:14 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 05:34:45
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 2184940..2185262 23..345 1615 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:39:42
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 2193038..2193360 23..345 1615 100 Plus
Blast to na_te.dros performed on 2019-03-16 05:34:46 has no hits.

IP03739.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 05:35:38 Download gff for IP03739.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 2078871..2079187 25..341 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:21:30 Download gff for IP03739.complete
Subject Subject Range Query Range Percent Splice Strand
CG17776-RA 1..213 48..260 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:21:25 Download gff for IP03739.complete
Subject Subject Range Query Range Percent Splice Strand
CG17776-RA 1..213 48..260 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:37:10 Download gff for IP03739.complete
Subject Subject Range Query Range Percent Splice Strand
CG17776-RA 1..213 48..260 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:05:21 Download gff for IP03739.complete
Subject Subject Range Query Range Percent Splice Strand
CG17776-RA 1..213 48..260 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:05:50 Download gff for IP03739.complete
Subject Subject Range Query Range Percent Splice Strand
CG17776-RA 1..213 48..260 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:22:13 Download gff for IP03739.complete
Subject Subject Range Query Range Percent Splice Strand
CG17776-RA 1..319 23..341 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:21:25 Download gff for IP03739.complete
Subject Subject Range Query Range Percent Splice Strand
CG17776-RA 1..319 23..341 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:37:10 Download gff for IP03739.complete
Subject Subject Range Query Range Percent Splice Strand
CG17776-RA 54..372 23..341 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:05:21 Download gff for IP03739.complete
Subject Subject Range Query Range Percent Splice Strand
CG17776-RA 1..319 23..341 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:05:50 Download gff for IP03739.complete
Subject Subject Range Query Range Percent Splice Strand
CG17776-RA 54..372 23..341 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:35:38 Download gff for IP03739.complete
Subject Subject Range Query Range Percent Splice Strand
X 2184940..2185258 23..341 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:35:38 Download gff for IP03739.complete
Subject Subject Range Query Range Percent Splice Strand
X 2184940..2185258 23..341 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 05:35:38 Download gff for IP03739.complete
Subject Subject Range Query Range Percent Splice Strand
X 2184940..2185258 23..341 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:37:10 Download gff for IP03739.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 2078973..2079291 23..341 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:41:43 Download gff for IP03739.complete
Subject Subject Range Query Range Percent Splice Strand
X 2193038..2193356 23..341 100   Plus

IP03739.hyp Sequence

Translation from 23 to 259

> IP03739.hyp
WTWKGFAAMQKKPINTNTLLDKLHRGAVYACIGVTLYGTYILGMRYYHYC
TVIRPEKQQAELKLLDEGAHDKAKELKY*

IP03739.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:06:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG17776-PB 70 CG17776-PB 1..70 9..78 374 100 Plus
CG17776-PA 70 CG17776-PA 1..70 9..78 374 100 Plus

IP03739.pep Sequence

Translation from 47 to 259

> IP03739.pep
MQKKPINTNTLLDKLHRGAVYACIGVTLYGTYILGMRYYHYCTVIRPEKQ
QAELKLLDEGAHDKAKELKY*

IP03739.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:46:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22199-PA 70 GF22199-PA 1..70 1..70 341 94.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:46:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG12917-PA 70 GG12917-PA 1..70 1..70 348 95.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:46:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11894-PA 74 GH11894-PA 1..74 1..70 325 85.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:25:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG17776-PB 70 CG17776-PB 1..70 1..70 374 100 Plus
CG17776-PA 70 CG17776-PA 1..70 1..70 374 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:46:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15903-PA 70 GI15903-PA 1..70 1..70 336 91.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:46:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13326-PA 70 GL13326-PA 1..70 1..70 343 94.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:46:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14659-PA 70 GA14659-PA 1..70 1..70 343 94.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:46:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19208-PA 70 GM19208-PA 1..70 1..70 349 95.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:46:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16812-PA 70 GJ16812-PA 1..70 1..70 339 92.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:46:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16051-PA 70 GK16051-PA 1..70 1..70 348 95.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:46:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16245-PA 70 GE16245-PA 1..70 1..70 353 97.1 Plus