Clone IP03754 Report

Search the DGRC for IP03754

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:37
Well:54
Vector:pOT2
Associated Gene/TranscriptCG2816-RB
Protein status:IP03754.pep: gold
Preliminary Size:292
Sequenced Size:569

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2816 2005-01-01 Successful iPCR screen
CG2816 2008-04-29 Release 5.5 accounting
CG2816 2008-08-15 Release 5.9 accounting
CG2816 2008-12-18 5.12 accounting

Clone Sequence Records

IP03754.complete Sequence

569 bp (569 high quality bases) assembled on 2005-03-04

GenBank Submission: BT023101

> IP03754.complete
CCAAGAACGTGACGGTTGAATATCGCTGCAAGTGGAAGTCGAGGGGACCT
CCGATCATCAAGTCTAGATGTCATGATGCCGGCTTATTGGCAGTGGCTTT
TGGTTGGCCTCCTCCTGTTGATTCCGCACCATTCAGGGGCGGCCTCCAAG
AGAGTGAAACTATGCCTGCAGCCCATGATCAGTGGTCGGTGCTTTGGATA
CGTTGAGAGCTATGCCTACAATCCCATTAAGCGCCATTGCGAACCCTTCA
TCTACGGCGGATGCGGCGGTAATGACAATCGATTTAGTACCAAAGCTGAG
TGCGAGTTCAACTGCCGTGATATTTGAGAATGTCAACTGAAATGTCACAG
TTACAATAACTACGATTGAAATTAAAAACTACAAACTGGTGGTTATGTTT
CCAAATATTCTATGTTGTGTTATTGAGGCAACATCCTAGATATTCATTCA
ATCTTAGGGTTAGAGTATTTCAAACTCCAACTGGATTTTCAATGTTTCTT
ATTAACAAAAATATATAACAAAATAAATTTTAATTCGAGTATAAAAAAAA
AAAAAAAAAAAAAAAAAAA

IP03754.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:51:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG2816-RB 643 CG2816-RB 102..643 1..542 2710 100 Plus
CG31778-RA 1240 CG31778-RA 1088..1240 547..395 765 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:22:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 3703378..3703767 153..542 1905 99.2 Plus
chr2L 23010047 chr2L 3703172..3703326 1..154 725 99.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:39:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:22:07
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3703864..3704258 153..547 1975 100 Plus
2L 23513712 2L 3703659..3703812 1..154 770 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:10:38
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3703864..3704258 153..547 1975 100 Plus
2L 23513712 2L 3703659..3703812 1..154 770 100 Plus
Blast to na_te.dros performed on 2019-03-15 15:22:07 has no hits.

IP03754.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:23:06 Download gff for IP03754.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 3703172..3703326 1..154 99 -> Plus
chr2L 3703380..3703718 155..493 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:21:32 Download gff for IP03754.complete
Subject Subject Range Query Range Percent Splice Strand
CG2816-RB 1..255 73..327 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:46:55 Download gff for IP03754.complete
Subject Subject Range Query Range Percent Splice Strand
CG2816-RB 1..255 73..327 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 01:25:59 Download gff for IP03754.complete
Subject Subject Range Query Range Percent Splice Strand
CG2816-RB 1..255 73..327 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:27:59 Download gff for IP03754.complete
Subject Subject Range Query Range Percent Splice Strand
CG2816-RA 18..276 67..327 98   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:03:56 Download gff for IP03754.complete
Subject Subject Range Query Range Percent Splice Strand
CG2816-RB 1..255 73..327 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:56:09 Download gff for IP03754.complete
Subject Subject Range Query Range Percent Splice Strand
CG2816-RB 1..542 1..542 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:46:55 Download gff for IP03754.complete
Subject Subject Range Query Range Percent Splice Strand
CG2816-RB 1..542 1..542 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 01:25:59 Download gff for IP03754.complete
Subject Subject Range Query Range Percent Splice Strand
CG2816-RB 1..542 1..542 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:27:59 Download gff for IP03754.complete
Subject Subject Range Query Range Percent Splice Strand
CG2816-RA 34..292 67..327 98   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:03:56 Download gff for IP03754.complete
Subject Subject Range Query Range Percent Splice Strand
CG2816-RB 1..542 1..542 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:23:06 Download gff for IP03754.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3703659..3703812 1..154 100 -> Plus
2L 3703866..3704253 155..542 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:23:06 Download gff for IP03754.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3703659..3703812 1..154 100 -> Plus
2L 3703866..3704253 155..542 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:23:06 Download gff for IP03754.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3703659..3703812 1..154 100 -> Plus
2L 3703866..3704253 155..542 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 01:25:59 Download gff for IP03754.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3703659..3703812 1..154 100 -> Plus
arm_2L 3703866..3704253 155..542 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:02:21 Download gff for IP03754.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3703866..3704253 155..542 100   Plus
2L 3703659..3703812 1..154 100 -> Plus

IP03754.hyp Sequence

Translation from 72 to 326

> IP03754.hyp
MMPAYWQWLLVGLLLLIPHHSGAASKRVKLCLQPMISGRCFGYVESYAYN
PIKRHCEPFIYGGCGGNDNRFSTKAECEFNCRDI*

IP03754.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:06:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG2816-PB 84 CG2816-PB 1..84 1..84 477 100 Plus
CG3604-PB 132 CG3604-PB 55..105 31..81 152 51 Plus
CG3604-PA 132 CG3604-PA 55..105 31..81 152 51 Plus
CG16712-PB 82 CG16712-PB 38..82 39..83 146 48.9 Plus
CG16712-PA 82 CG16712-PA 38..82 39..83 146 48.9 Plus

IP03754.pep Sequence

Translation from 72 to 326

> IP03754.pep
MMPAYWQWLLVGLLLLIPHHSGAASKRVKLCLQPMISGRCFGYVESYAYN
PIKRHCEPFIYGGCGGNDNRFSTKAECEFNCRDI*

IP03754.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:40:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15248-PA 82 GF15248-PA 1..82 2..84 319 78.3 Plus
Dana\GF15247-PA 82 GF15247-PA 27..82 32..83 148 51.8 Plus
Dana\GF14656-PA 88 GF14656-PA 9..88 9..83 143 37.8 Plus
Dana\GF14655-PA 81 GF14655-PA 3..81 9..83 143 38 Plus
Dana\GF14654-PA 82 GF14654-PA 38..82 39..83 142 55.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:40:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24959-PA 83 GG24959-PA 1..83 2..84 434 95.2 Plus
Dere\GG24408-PA 132 GG24408-PA 55..105 31..81 147 51 Plus
Dere\GG12068-PA 2895 GG12068-PA 1993..2048 26..81 147 48.2 Plus
Dere\GG12068-PA 2895 GG12068-PA 1717..1776 23..82 139 43.3 Plus
Dere\GG24413-PA 82 GG24413-PA 3..80 9..81 132 35.9 Plus
Dere\GG16686-PA 84 GG16686-PA 3..82 15..81 132 40 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:40:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13701-PA 81 GH13701-PA 20..81 23..84 289 82.3 Plus
Dgri\GH22482-PA 86 GH22482-PA 1..86 1..83 150 36 Plus
Dgri\GH13178-PA 135 GH13178-PA 53..103 31..81 149 52.9 Plus
Dgri\GH13180-PA 81 GH13180-PA 38..80 39..81 139 53.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:20:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG2816-PB 84 CG2816-PB 1..84 1..84 477 100 Plus
CG3604-PB 132 CG3604-PB 55..105 31..81 152 51 Plus
CG3604-PA 132 CG3604-PA 55..105 31..81 152 51 Plus
Ppn-PC 2174 CG33103-PC 1722..1781 23..82 148 45 Plus
Ppn-PF 2776 CG33103-PF 1722..1781 23..82 148 45 Plus
Ppn-PG 2841 CG33103-PG 1722..1781 23..82 148 45 Plus
Ppn-PE 2898 CG33103-PE 1722..1781 23..82 148 45 Plus
IM33-PB 82 CG16712-PB 38..82 39..83 146 48.9 Plus
IM33-PA 82 CG16712-PA 38..82 39..83 146 48.9 Plus
Ppn-PF 2776 CG33103-PF 1998..2051 28..81 145 46.3 Plus
Ppn-PG 2841 CG33103-PG 1941..1994 28..81 145 46.3 Plus
Ppn-PE 2898 CG33103-PE 1998..2051 28..81 145 46.3 Plus
CG3513-PA 88 CG3513-PA 45..88 40..83 141 50 Plus
CG42828-PB 89 CG42828-PB 20..81 23..84 140 40.3 Plus
CG15418-PB 97 CG15418-PB 16..91 9..81 134 38.2 Plus
CG15418-PA 97 CG15418-PA 16..91 9..81 134 38.2 Plus
CG42827-PD 116 CG42827-PD 37..91 27..81 134 47.3 Plus
CG42827-PC 116 CG6784-PB 37..91 27..81 134 47.3 Plus
CG31515-PB 129 CG31515-PB 38..97 22..81 133 41.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:40:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23887-PA 88 GI23887-PA 27..88 23..84 279 79 Plus
Dmoj\GI17756-PA 142 GI17756-PA 55..105 31..81 159 56.9 Plus
Dmoj\GI17755-PA 121 GI17755-PA 54..117 18..81 135 42.2 Plus
Dmoj\GI17758-PA 82 GI17758-PA 39..82 40..83 134 56.8 Plus
Dmoj\GI18884-PA 85 GI18884-PA 25..75 31..81 132 51 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:40:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18667-PA 88 GL18667-PA 13..88 8..84 327 76.6 Plus
Dper\GL19427-PA 78 GL19427-PA 5..78 9..83 150 45.5 Plus
Dper\GL19460-PA 80 GL19460-PA 4..80 13..83 150 45.1 Plus
Dper\GL19458-PA 129 GL19458-PA 48..98 31..81 139 51 Plus
Dper\GL19464-PA 89 GL19464-PA 3..89 5..83 136 33.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:40:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15472-PA 88 GA15472-PA 13..88 8..84 327 76.6 Plus
Dpse\GA25956-PA 78 GA25956-PA 5..78 9..83 154 46.8 Plus
Dpse\GA25969-PA 80 GA25969-PA 4..80 13..83 147 45.1 Plus
Dpse\GA17552-PA 129 GA17552-PA 48..98 31..81 139 51 Plus
Dpse\GA30051-PA 93 GA30051-PA 26..83 24..81 133 41.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:40:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18428-PA 91 GM18428-PA 9..91 2..84 437 96.4 Plus
Dsec\GM18125-PA 130 GM18125-PA 35..103 3..81 146 39.2 Plus
Dsec\GM16292-PA 2898 GM16292-PA 1719..1780 21..82 145 45.2 Plus
Dsec\GM18130-PA 88 GM18130-PA 3..88 5..83 141 33.7 Plus
Dsec\GM16292-PA 2898 GM16292-PA 1997..2050 28..81 138 46.3 Plus
Dsec\GM18127-PA 82 GM18127-PA 38..82 39..83 135 48.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:40:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23247-PA 91 GD23247-PA 9..91 2..84 440 97.6 Plus
Dsim\GD22733-PA 130 GD22733-PA 35..103 3..81 147 39.2 Plus
Dsim\GD18032-PA 2901 GD18032-PA 1724..1783 23..82 143 45 Plus
Dsim\GD22737-PA 88 GD22737-PA 3..88 5..83 142 33.7 Plus
Dsim\GD18032-PA 2901 GD18032-PA 2000..2053 28..81 138 46.3 Plus
Dsim\GD22734-PA 82 GD22734-PA 38..82 39..83 136 48.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:40:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21147-PA 85 GJ21147-PA 24..85 23..84 275 77.4 Plus
Dvir\GJ17584-PA 144 GJ17584-PA 47..104 24..81 144 46.6 Plus
Dvir\GJ21125-PA 80 GJ21125-PA 3..80 9..83 140 35.9 Plus
Dvir\GJ14166-PA 3023 GJ14166-PA 2113..2164 30..81 139 50 Plus
Dvir\GJ16348-PA 86 GJ16348-PA 43..86 40..83 127 45.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:40:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14644-PA 82 GK14644-PA 1..82 1..84 328 76.2 Plus
Dwil\GK10999-PA 2909 GK10999-PA 1996..2049 28..81 149 50 Plus
Dwil\GK15468-PA 117 GK15468-PA 37..87 31..81 147 54.9 Plus
Dwil\GK17598-PA 1790 GK17598-PA 136..199 19..81 139 42.2 Plus
Dwil\GK15471-PA 90 GK15471-PA 1..90 2..83 136 31.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:40:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18250-PA 84 GE18250-PA 1..84 2..84 426 95.2 Plus
Dyak\GE14811-PA 130 GE14811-PA 55..105 31..81 146 51 Plus
Dyak\GE10512-PA 2898 GE10512-PA 1726..1785 23..82 143 45 Plus
Dyak\GE10512-PA 2898 GE10512-PA 2001..2051 31..81 138 47.1 Plus
Dyak\GE14817-PA 106 GE14817-PA 21..106 5..83 133 30.2 Plus
Dyak\GE14815-PA 82 GE14815-PA 27..82 32..83 132 42.9 Plus