BDGP Sequence Production Resources |
Search the DGRC for IP03767
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 37 |
Well: | 67 |
Vector: | pOT2 |
Associated Gene/Transcript | CG32069-RA |
Protein status: | IP03767.pep: gold |
Preliminary Size: | 243 |
Sequenced Size: | 376 |
Gene | Date | Evidence |
---|---|---|
CG32069 | 2005-01-01 | Successful iPCR screen |
CG32069 | 2008-04-29 | Release 5.5 accounting |
CG32069 | 2008-08-15 | Release 5.9 accounting |
CG32069 | 2008-12-18 | 5.12 accounting |
376 bp (376 high quality bases) assembled on 2004-12-17
GenBank Submission: BT023689
> IP03767.complete CATCACTGACGTCAACAATTATTGGCGATTTTGGTTTATTTTGATGTAAA TAGGAATAACTTCGCGCAATTATGTTTACTTTGTGGACACTGATTGAATC TTCACTCCTGTGCCTGAATGCGGTGTGCATTCTGCACGAGGAACGCTTTC TGGCCAAGTTTGGCTGGGGACGACAGGCGGGCCAGCAGGACTTTGGAGCA CCTACGGCCAAGGATCAGGTGCTAAACCTCATTCGTTCCATACGCACAGT GGCCAAAATTCCCCTGATATTCCTTAACATAATTGCGATTATATTTAAAC TATTACTTGGTTGACATAGAATCTAATATAATAAATGTGTACCATAAAGC CCTTTTAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 11053334..11053492 | 159..1 | 780 | 99.4 | Minus |
chr3L | 24539361 | chr3L | 11053169..11053267 | 258..160 | 495 | 100 | Minus |
chr3L | 24539361 | chr3L | 11053009..11053106 | 356..259 | 490 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 11062456..11062614 | 159..1 | 795 | 100 | Minus |
3L | 28110227 | 3L | 11062129..11062228 | 358..259 | 500 | 100 | Minus |
3L | 28110227 | 3L | 11062291..11062389 | 258..160 | 495 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 11055556..11055714 | 159..1 | 795 | 100 | Minus |
3L | 28103327 | 3L | 11055229..11055328 | 358..259 | 500 | 100 | Minus |
3L | 28103327 | 3L | 11055391..11055489 | 258..160 | 495 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 11053009..11053106 | 259..356 | 100 | <- | Minus |
chr3L | 11053169..11053267 | 160..258 | 100 | <- | Minus |
chr3L | 11053334..11053492 | 1..159 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32069-RA | 1..243 | 72..314 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32069-RA | 1..243 | 72..314 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32069-RA | 1..243 | 72..314 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32069-RA | 1..243 | 72..314 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32069-RA | 1..243 | 72..314 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32069-RA | 1..356 | 1..356 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32069-RA | 1..356 | 1..356 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32069-RA | 1..356 | 1..356 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32069-RA | 1..243 | 72..314 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG32069-RA | 1..356 | 1..356 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 11062131..11062228 | 259..356 | 100 | <- | Minus |
3L | 11062291..11062389 | 160..258 | 100 | <- | Minus |
3L | 11062456..11062614 | 1..159 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 11062131..11062228 | 259..356 | 100 | <- | Minus |
3L | 11062291..11062389 | 160..258 | 100 | <- | Minus |
3L | 11062456..11062614 | 1..159 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 11062131..11062228 | 259..356 | 100 | <- | Minus |
3L | 11062291..11062389 | 160..258 | 100 | <- | Minus |
3L | 11062456..11062614 | 1..159 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 11055231..11055328 | 259..356 | 100 | <- | Minus |
arm_3L | 11055391..11055489 | 160..258 | 100 | <- | Minus |
arm_3L | 11055556..11055714 | 1..159 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 11055231..11055328 | 259..356 | 100 | <- | Minus |
3L | 11055391..11055489 | 160..258 | 100 | <- | Minus |
3L | 11055556..11055714 | 1..159 | 100 | Minus |
Translation from 71 to 313
> IP03767.hyp MFTLWTLIESSLLCLNAVCILHEERFLAKFGWGRQAGQQDFGAPTAKDQV LNLIRSIRTVAKIPLIFLNIIAIIFKLLLG*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG32069-PA | 80 | CG32069-PA | 1..80 | 1..80 | 406 | 100 | Plus |
Translation from 71 to 313
> IP03767.pep MFTLWTLIESSLLCLNAVCILHEERFLAKFGWGRQAGQQDFGAPTAKDQV LNLIRSIRTVAKIPLIFLNIIAIIFKLLLG*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23809-PA | 80 | GF23809-PA | 1..80 | 1..80 | 405 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG13948-PA | 80 | GG13948-PA | 1..80 | 1..80 | 407 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH16574-PA | 80 | GH16574-PA | 1..80 | 1..80 | 402 | 97.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG32069-PA | 80 | CG32069-PA | 1..80 | 1..80 | 406 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13865-PA | 80 | GI13865-PA | 1..80 | 1..80 | 402 | 97.5 | Plus |
Dmoj\GI16182-PA | 80 | GI16182-PA | 1..80 | 1..80 | 318 | 76.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL15743-PA | 80 | GL15743-PA | 1..80 | 1..80 | 405 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA16656-PA | 80 | GA16656-PA | 1..80 | 1..80 | 405 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM24783-PA | 80 | GM24783-PA | 1..80 | 1..80 | 408 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD12834-PA | 80 | GD12834-PA | 1..80 | 1..80 | 403 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ11726-PA | 80 | GJ11726-PA | 1..80 | 1..80 | 396 | 95 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK11461-PA | 80 | GK11461-PA | 1..80 | 1..80 | 392 | 95 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE20246-PA | 80 | GE20246-PA | 1..80 | 1..80 | 408 | 100 | Plus |