Clone IP03767 Report

Search the DGRC for IP03767

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:37
Well:67
Vector:pOT2
Associated Gene/TranscriptCG32069-RA
Protein status:IP03767.pep: gold
Preliminary Size:243
Sequenced Size:376

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32069 2005-01-01 Successful iPCR screen
CG32069 2008-04-29 Release 5.5 accounting
CG32069 2008-08-15 Release 5.9 accounting
CG32069 2008-12-18 5.12 accounting

Clone Sequence Records

IP03767.complete Sequence

376 bp (376 high quality bases) assembled on 2004-12-17

GenBank Submission: BT023689

> IP03767.complete
CATCACTGACGTCAACAATTATTGGCGATTTTGGTTTATTTTGATGTAAA
TAGGAATAACTTCGCGCAATTATGTTTACTTTGTGGACACTGATTGAATC
TTCACTCCTGTGCCTGAATGCGGTGTGCATTCTGCACGAGGAACGCTTTC
TGGCCAAGTTTGGCTGGGGACGACAGGCGGGCCAGCAGGACTTTGGAGCA
CCTACGGCCAAGGATCAGGTGCTAAACCTCATTCGTTCCATACGCACAGT
GGCCAAAATTCCCCTGATATTCCTTAACATAATTGCGATTATATTTAAAC
TATTACTTGGTTGACATAGAATCTAATATAATAAATGTGTACCATAAAGC
CCTTTTAAAAAAAAAAAAAAAAAAAA

IP03767.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 16:24:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG32069-RA 484 CG32069-RA 110..467 1..358 1790 100 Plus
CG14145-RA 645 CG14145-RA 559..645 358..272 435 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:53:34
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 11053334..11053492 159..1 780 99.4 Minus
chr3L 24539361 chr3L 11053169..11053267 258..160 495 100 Minus
chr3L 24539361 chr3L 11053009..11053106 356..259 490 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:39:20 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:53:33
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 11062456..11062614 159..1 795 100 Minus
3L 28110227 3L 11062129..11062228 358..259 500 100 Minus
3L 28110227 3L 11062291..11062389 258..160 495 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 18:12:54
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 11055556..11055714 159..1 795 100 Minus
3L 28103327 3L 11055229..11055328 358..259 500 100 Minus
3L 28103327 3L 11055391..11055489 258..160 495 100 Minus
Blast to na_te.dros performed on 2019-03-16 07:53:33 has no hits.

IP03767.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:54:44 Download gff for IP03767.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 11053009..11053106 259..356 100 <- Minus
chr3L 11053169..11053267 160..258 100 <- Minus
chr3L 11053334..11053492 1..159 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:21:34 Download gff for IP03767.complete
Subject Subject Range Query Range Percent Splice Strand
CG32069-RA 1..243 72..314 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:49:15 Download gff for IP03767.complete
Subject Subject Range Query Range Percent Splice Strand
CG32069-RA 1..243 72..314 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 09:45:53 Download gff for IP03767.complete
Subject Subject Range Query Range Percent Splice Strand
CG32069-RA 1..243 72..314 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 13:44:01 Download gff for IP03767.complete
Subject Subject Range Query Range Percent Splice Strand
CG32069-RA 1..243 72..314 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:43:38 Download gff for IP03767.complete
Subject Subject Range Query Range Percent Splice Strand
CG32069-RA 1..243 72..314 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 16:41:02 Download gff for IP03767.complete
Subject Subject Range Query Range Percent Splice Strand
CG32069-RA 1..356 1..356 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:49:15 Download gff for IP03767.complete
Subject Subject Range Query Range Percent Splice Strand
CG32069-RA 1..356 1..356 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 09:45:53 Download gff for IP03767.complete
Subject Subject Range Query Range Percent Splice Strand
CG32069-RA 1..356 1..356 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 13:44:02 Download gff for IP03767.complete
Subject Subject Range Query Range Percent Splice Strand
CG32069-RA 1..243 72..314 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:43:38 Download gff for IP03767.complete
Subject Subject Range Query Range Percent Splice Strand
CG32069-RA 1..356 1..356 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:54:44 Download gff for IP03767.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11062131..11062228 259..356 100 <- Minus
3L 11062291..11062389 160..258 100 <- Minus
3L 11062456..11062614 1..159 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:54:44 Download gff for IP03767.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11062131..11062228 259..356 100 <- Minus
3L 11062291..11062389 160..258 100 <- Minus
3L 11062456..11062614 1..159 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:54:44 Download gff for IP03767.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11062131..11062228 259..356 100 <- Minus
3L 11062291..11062389 160..258 100 <- Minus
3L 11062456..11062614 1..159 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 09:45:53 Download gff for IP03767.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 11055231..11055328 259..356 100 <- Minus
arm_3L 11055391..11055489 160..258 100 <- Minus
arm_3L 11055556..11055714 1..159 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 11:34:58 Download gff for IP03767.complete
Subject Subject Range Query Range Percent Splice Strand
3L 11055231..11055328 259..356 100 <- Minus
3L 11055391..11055489 160..258 100 <- Minus
3L 11055556..11055714 1..159 100   Minus

IP03767.hyp Sequence

Translation from 71 to 313

> IP03767.hyp
MFTLWTLIESSLLCLNAVCILHEERFLAKFGWGRQAGQQDFGAPTAKDQV
LNLIRSIRTVAKIPLIFLNIIAIIFKLLLG*

IP03767.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:06:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG32069-PA 80 CG32069-PA 1..80 1..80 406 100 Plus

IP03767.pep Sequence

Translation from 71 to 313

> IP03767.pep
MFTLWTLIESSLLCLNAVCILHEERFLAKFGWGRQAGQQDFGAPTAKDQV
LNLIRSIRTVAKIPLIFLNIIAIIFKLLLG*

IP03767.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:51:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23809-PA 80 GF23809-PA 1..80 1..80 405 98.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:51:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13948-PA 80 GG13948-PA 1..80 1..80 407 98.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:51:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16574-PA 80 GH16574-PA 1..80 1..80 402 97.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG32069-PA 80 CG32069-PA 1..80 1..80 406 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:51:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13865-PA 80 GI13865-PA 1..80 1..80 402 97.5 Plus
Dmoj\GI16182-PA 80 GI16182-PA 1..80 1..80 318 76.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:51:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15743-PA 80 GL15743-PA 1..80 1..80 405 98.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:51:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16656-PA 80 GA16656-PA 1..80 1..80 405 98.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:51:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24783-PA 80 GM24783-PA 1..80 1..80 408 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:51:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12834-PA 80 GD12834-PA 1..80 1..80 403 98.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:51:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11726-PA 80 GJ11726-PA 1..80 1..80 396 95 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:51:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11461-PA 80 GK11461-PA 1..80 1..80 392 95 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:51:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20246-PA 80 GE20246-PA 1..80 1..80 408 100 Plus