Clone IP03783 Report

Search the DGRC for IP03783

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:37
Well:83
Vector:pOT2
Associated Gene/Transcriptubl-RA
Protein status:IP03783.pep: gold
Preliminary Size:239
Sequenced Size:435

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3450 2005-01-01 Successful iPCR screen
ubl 2008-04-29 Release 5.5 accounting
ubl 2008-08-15 Release 5.9 accounting
ubl 2008-12-18 5.12 accounting

Clone Sequence Records

IP03783.complete Sequence

435 bp (435 high quality bases) assembled on 2004-12-17

GenBank Submission: BT023690

> IP03783.complete
ATTTGACAACCCTAAGCAATAATACCACAACAAATCAAGAATTTATTGTT
GTGATTTGTCTAGCAAAGCCATAAAATATGATAGAAATAACGTGTAACGA
TCGTCTTGGCAAGAAGGTGCGCGTCAAGTGCAACCCGGACGACACGATTG
GGGACCTCAAGAAACTAATCGCGGCACAAACGGGCACAAAGCACGAGAAG
ATTGTCCTGAAGAAGTGGTACACAATCTTCAAGGACCCGATTCGCCTATC
TGACTATGAAATTCACGATGGCATGAATCTGGAACTTTACTACCAATAAA
ACTGCAAGGGAATACCGTTCCTGTGTCTAGTTTGTCCAATTTTTATAGCT
TCTTTAATAAATAAAAAGATTTTGAATAATAAAAAAAAAAAAAAAAAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

IP03783.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:50:23
Subject Length Description Subject Range Query Range Score Percent Strand
ubl-RA 475 ubl-RA 48..428 1..381 1905 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:30:44
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 2697440..2697580 255..115 705 100 Minus
chr2R 21145070 chr2R 2697250..2697374 380..256 625 100 Minus
chr2R 21145070 chr2R 2697636..2697753 118..1 590 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:39:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:30:42
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6810201..6810341 255..115 705 100 Minus
2R 25286936 2R 6810010..6810135 381..256 630 100 Minus
2R 25286936 2R 6810397..6810514 118..1 590 100 Minus
3R 32079331 3R 18606556..18606627 427..356 240 88.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:39:43
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 6811400..6811540 255..115 705 100 Minus
2R 25260384 2R 6811209..6811334 381..256 630 100 Minus
2R 25260384 2R 6811596..6811713 118..1 590 100 Minus
Blast to na_te.dros performed 2019-03-16 00:30:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 5227..5256 61..32 105 83.3 Minus
Tabor 7345 Tabor TABOR 7345bp 1166..1212 333..380 102 70.8 Plus

IP03783.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:31:33 Download gff for IP03783.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 2697638..2697753 1..116 100   Minus
chr2R 2697440..2697578 117..255 100 <- Minus
chr2R 2697250..2697374 256..380 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:21:43 Download gff for IP03783.complete
Subject Subject Range Query Range Percent Splice Strand
ubl-RA 1..222 78..299 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:21:26 Download gff for IP03783.complete
Subject Subject Range Query Range Percent Splice Strand
ubl-RA 1..222 78..299 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:51:23 Download gff for IP03783.complete
Subject Subject Range Query Range Percent Splice Strand
ubl-RA 1..222 78..299 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:05:22 Download gff for IP03783.complete
Subject Subject Range Query Range Percent Splice Strand
ubl-RA 1..222 78..299 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:04:26 Download gff for IP03783.complete
Subject Subject Range Query Range Percent Splice Strand
ubl-RA 1..222 78..299 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:22:14 Download gff for IP03783.complete
Subject Subject Range Query Range Percent Splice Strand
ubl-RA 1..380 1..380 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:21:26 Download gff for IP03783.complete
Subject Subject Range Query Range Percent Splice Strand
ubl-RA 1..380 1..380 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:51:23 Download gff for IP03783.complete
Subject Subject Range Query Range Percent Splice Strand
ubl-RA 17..396 1..380 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:05:22 Download gff for IP03783.complete
Subject Subject Range Query Range Percent Splice Strand
ubl-RA 1..380 1..380 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:04:26 Download gff for IP03783.complete
Subject Subject Range Query Range Percent Splice Strand
ubl-RA 17..396 1..380 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:31:33 Download gff for IP03783.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6810011..6810135 256..380 100 <- Minus
2R 6810201..6810339 117..255 100 <- Minus
2R 6810399..6810514 1..116 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:31:33 Download gff for IP03783.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6810011..6810135 256..380 100 <- Minus
2R 6810201..6810339 117..255 100 <- Minus
2R 6810399..6810514 1..116 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:31:33 Download gff for IP03783.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6810011..6810135 256..380 100 <- Minus
2R 6810201..6810339 117..255 100 <- Minus
2R 6810399..6810514 1..116 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:51:23 Download gff for IP03783.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 2697516..2697640 256..380 100 <- Minus
arm_2R 2697706..2697844 117..255 100 <- Minus
arm_2R 2697904..2698019 1..116 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:41:44 Download gff for IP03783.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6811210..6811334 256..380 100 <- Minus
2R 6811400..6811538 117..255 100 <- Minus
2R 6811598..6811713 1..116 100   Minus

IP03783.hyp Sequence

Translation from 77 to 298

> IP03783.hyp
MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTKHEKIVLKKWYTI
FKDPIRLSDYEIHDGMNLELYYQ*

IP03783.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:06:52
Subject Length Description Subject Range Query Range Score Percent Strand
ubl-PA 73 CG3450-PA 1..73 1..73 391 100 Plus

IP03783.pep Sequence

Translation from 77 to 298

> IP03783.pep
MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTKHEKIVLKKWYTI
FKDPIRLSDYEIHDGMNLELYYQ*

IP03783.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:46:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13785-PA 73 GF13785-PA 1..73 1..73 379 98.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:46:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10794-PA 73 GG10794-PA 1..73 1..73 379 98.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:46:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21758-PA 73 GH21758-PA 1..73 1..73 378 97.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:22:50
Subject Length Description Subject Range Query Range Score Percent Strand
ubl-PA 73 CG3450-PA 1..73 1..73 391 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:46:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\Tes39-PA 73 GI19304-PA 1..73 1..73 379 98.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:46:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10969-PA 73 GL10969-PA 1..73 1..73 378 97.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:46:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17459-PA 73 GA17459-PA 1..73 1..73 378 97.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:46:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20845-PA 73 GM20845-PA 1..73 1..73 383 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:46:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10297-PA 73 GD10297-PA 1..73 1..73 383 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:46:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22181-PA 73 GJ22181-PA 1..73 1..73 379 98.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:46:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22148-PA 73 GK22148-PA 1..73 1..73 379 98.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:46:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24432-PA 73 GE24432-PA 1..73 1..73 379 98.6 Plus