BDGP Sequence Production Resources |
Search the DGRC for IP03783
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 37 |
Well: | 83 |
Vector: | pOT2 |
Associated Gene/Transcript | ubl-RA |
Protein status: | IP03783.pep: gold |
Preliminary Size: | 239 |
Sequenced Size: | 435 |
Gene | Date | Evidence |
---|---|---|
CG3450 | 2005-01-01 | Successful iPCR screen |
ubl | 2008-04-29 | Release 5.5 accounting |
ubl | 2008-08-15 | Release 5.9 accounting |
ubl | 2008-12-18 | 5.12 accounting |
435 bp (435 high quality bases) assembled on 2004-12-17
GenBank Submission: BT023690
> IP03783.complete ATTTGACAACCCTAAGCAATAATACCACAACAAATCAAGAATTTATTGTT GTGATTTGTCTAGCAAAGCCATAAAATATGATAGAAATAACGTGTAACGA TCGTCTTGGCAAGAAGGTGCGCGTCAAGTGCAACCCGGACGACACGATTG GGGACCTCAAGAAACTAATCGCGGCACAAACGGGCACAAAGCACGAGAAG ATTGTCCTGAAGAAGTGGTACACAATCTTCAAGGACCCGATTCGCCTATC TGACTATGAAATTCACGATGGCATGAATCTGGAACTTTACTACCAATAAA ACTGCAAGGGAATACCGTTCCTGTGTCTAGTTTGTCCAATTTTTATAGCT TCTTTAATAAATAAAAAGATTTTGAATAATAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
ubl-RA | 475 | ubl-RA | 48..428 | 1..381 | 1905 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 2697440..2697580 | 255..115 | 705 | 100 | Minus |
chr2R | 21145070 | chr2R | 2697250..2697374 | 380..256 | 625 | 100 | Minus |
chr2R | 21145070 | chr2R | 2697636..2697753 | 118..1 | 590 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 6810201..6810341 | 255..115 | 705 | 100 | Minus |
2R | 25286936 | 2R | 6810010..6810135 | 381..256 | 630 | 100 | Minus |
2R | 25286936 | 2R | 6810397..6810514 | 118..1 | 590 | 100 | Minus |
3R | 32079331 | 3R | 18606556..18606627 | 427..356 | 240 | 88.9 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 2697638..2697753 | 1..116 | 100 | Minus | |
chr2R | 2697440..2697578 | 117..255 | 100 | <- | Minus |
chr2R | 2697250..2697374 | 256..380 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ubl-RA | 1..222 | 78..299 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ubl-RA | 1..222 | 78..299 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ubl-RA | 1..222 | 78..299 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ubl-RA | 1..222 | 78..299 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ubl-RA | 1..222 | 78..299 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ubl-RA | 1..380 | 1..380 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ubl-RA | 1..380 | 1..380 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ubl-RA | 17..396 | 1..380 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ubl-RA | 1..380 | 1..380 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
ubl-RA | 17..396 | 1..380 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 6810011..6810135 | 256..380 | 100 | <- | Minus |
2R | 6810201..6810339 | 117..255 | 100 | <- | Minus |
2R | 6810399..6810514 | 1..116 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 6810011..6810135 | 256..380 | 100 | <- | Minus |
2R | 6810201..6810339 | 117..255 | 100 | <- | Minus |
2R | 6810399..6810514 | 1..116 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 6810011..6810135 | 256..380 | 100 | <- | Minus |
2R | 6810201..6810339 | 117..255 | 100 | <- | Minus |
2R | 6810399..6810514 | 1..116 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 2697516..2697640 | 256..380 | 100 | <- | Minus |
arm_2R | 2697706..2697844 | 117..255 | 100 | <- | Minus |
arm_2R | 2697904..2698019 | 1..116 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 6811210..6811334 | 256..380 | 100 | <- | Minus |
2R | 6811400..6811538 | 117..255 | 100 | <- | Minus |
2R | 6811598..6811713 | 1..116 | 100 | Minus |
Translation from 77 to 298
> IP03783.hyp MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTKHEKIVLKKWYTI FKDPIRLSDYEIHDGMNLELYYQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
ubl-PA | 73 | CG3450-PA | 1..73 | 1..73 | 391 | 100 | Plus |
Translation from 77 to 298
> IP03783.pep MIEITCNDRLGKKVRVKCNPDDTIGDLKKLIAAQTGTKHEKIVLKKWYTI FKDPIRLSDYEIHDGMNLELYYQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13785-PA | 73 | GF13785-PA | 1..73 | 1..73 | 379 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG10794-PA | 73 | GG10794-PA | 1..73 | 1..73 | 379 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH21758-PA | 73 | GH21758-PA | 1..73 | 1..73 | 378 | 97.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
ubl-PA | 73 | CG3450-PA | 1..73 | 1..73 | 391 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\Tes39-PA | 73 | GI19304-PA | 1..73 | 1..73 | 379 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL10969-PA | 73 | GL10969-PA | 1..73 | 1..73 | 378 | 97.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA17459-PA | 73 | GA17459-PA | 1..73 | 1..73 | 378 | 97.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM20845-PA | 73 | GM20845-PA | 1..73 | 1..73 | 383 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD10297-PA | 73 | GD10297-PA | 1..73 | 1..73 | 383 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ22181-PA | 73 | GJ22181-PA | 1..73 | 1..73 | 379 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK22148-PA | 73 | GK22148-PA | 1..73 | 1..73 | 379 | 98.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE24432-PA | 73 | GE24432-PA | 1..73 | 1..73 | 379 | 98.6 | Plus |