Clone IP03784 Report

Search the DGRC for IP03784

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:37
Well:84
Vector:pOT2
Associated Gene/TranscriptCG3513-RA
Protein status:IP03784.pep: gold
Preliminary Size:267
Sequenced Size:1003

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3513 2005-01-01 Successful iPCR screen
CG3513 2008-04-29 Release 5.5 accounting
Acp24A4 2008-08-15 Release 5.9 accounting
CG3513 2008-08-15 Release 5.9 accounting
CG3513 2008-12-18 5.12 accounting
Acp24A4 2008-12-18 5.12 accounting

Clone Sequence Records

IP03784.complete Sequence

1003 bp (1003 high quality bases) assembled on 2004-12-17

GenBank Submission: BT023687

> IP03784.complete
ACTAAGTCAGTTAAAGGTTCCCAATATCTTTCGCCATGAAGCTGCTGATT
CTTCTTTTTGTTTTCATCGCTCTTGCAAGCAATTCTTTGGCTCTGAAAAA
TGAAATCTGTGGATTACCCGCTGCCGCTAATGGGCAACGAAAATTCATTT
GAATCCCAGGAAGAGTGTATAAATAAGTGCGTGGAGTAATATCTCTACGA
AGATATCTGTATCTATGATCTGAATGTATGCGTACGAAACACAAGAAACA
TTTAGTTAGCCTTACAAATCATCATTTAAGAGCAAGAAACTTTCTGAAAC
GAGGGGAAGGCACAATCTAAGCTTGATTTTTTAATCTAGCCCGAAGTACA
TAATGCTTCACTATTTAATGTACAAATAGATTTACAAGACTAACATCTGC
ACTTACATGTATGTGCCAGTTCTTAGCTATCTGCCTACTTTCTATATAAG
GCTGGCGGACATGCAAGATAAGCCATAGCCATATTCTTCCCGATTTCTGC
GTATATGTACACCTCTATAAAACGCTGGCGAGACAAAGTCTGGCCCACCA
TAGTTCAACTGAAGTTTTGTCGAAAATGAAGTATATCGGCTTTGTCGCCA
TCGCCTTTTTGCTGAGTCTGTCCGGCAGTCGTTTATGGGTGCATGCCAAG
CCGGAGATGTGCCAGCAGCCCTCTTCGATGGTGGGCATGGCGCAGGATGG
AGCTGCCTGCATGGCTTTTATGCCGGCCTGGACCTATGATGCCTCCAAAA
ACGCCTGCACCGAGTTCATTTTCGGTGGCTGCGGTGGAAACTCCAATCAG
TTCTCTACCAAGAGTGAATGCGAAAAGGCCTGCAAGGACTAAAGAAATAC
GAAATCACATCTTCACATCTTGGGCAAAACCCACAGCCTAAAACAAAACA
ATCTTGTAACTTAAAAGCCAAAACAAACAGTCGGCAATCTGGTTTCGCAA
AATGGCAAACAAAATAAAAACCATACTCAACAATAAAAAAAAAAAAAAAA
AAA

IP03784.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:50:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG3513-RA 582 CG3513-RA 1..580 406..985 2900 100 Plus
Acp24A4-RB 342 Acp24A4-RB 209..342 132..265 670 100 Plus
Acp24A4-RB 342 Acp24A4-RB 1..127 7..133 635 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 00:40:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 3692614..3693136 654..132 2555 99.2 Minus
chr2L 23010047 chr2L 3692223..3692553 984..654 1655 100 Minus
chr2L 23010047 chr2L 3693318..3693419 102..1 510 100 Minus
chr2L 23010047 chr2L 3693610..3693685 208..133 230 86.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:39:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 00:40:57
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3693090..3693612 654..132 2615 100 Minus
2L 23513712 2L 3692698..3693029 985..654 1660 100 Minus
2L 23513712 2L 3693794..3693895 102..1 510 100 Minus
2L 23513712 2L 3694086..3694161 208..133 230 86.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:39:44
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 3693090..3693612 654..132 2615 100 Minus
2L 23513712 2L 3692698..3693029 985..654 1660 100 Minus
2L 23513712 2L 3693794..3693895 102..1 510 100 Minus
2L 23513712 2L 3694086..3694161 208..133 230 86.8 Minus
2L 23513712 2L 3693694..3693725 133..102 160 100 Minus
Blast to na_te.dros performed 2019-03-16 00:40:57
Subject Length Description Subject Range Query Range Score Percent Strand
mdg1 7480 mdg1 DMRTMGD1 7480bp Derived from X59545 (g8507) (Rel. 49, Last updated, Version 4). 6761..6868 876..984 119 57.8 Plus
Dvir\Penelope 4158 Dvir\Penelope DV49102 4158bp Derived from U49102 (Rel. 69, Last updated, Version 4). 1065..1101 947..983 113 78.4 Plus
Penelope 804 Penelope 804bp Derived from AF418572 (AF418572) (Rel. 70, Last updated, Version 3). 620..656 947..983 113 78.4 Plus

IP03784.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 00:42:07 Download gff for IP03784.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 3692223..3692552 655..984 100 <- Minus
chr2L 3692614..3693135 133..654 99 <- Minus
chr2L 3693219..3693248 103..132 100 <- Minus
chr2L 3693318..3693419 1..102 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:21:44 Download gff for IP03784.complete
Subject Subject Range Query Range Percent Splice Strand
CG3513-RA 1..267 576..842 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:21:27 Download gff for IP03784.complete
Subject Subject Range Query Range Percent Splice Strand
CG3513-RA 1..267 576..842 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:51:40 Download gff for IP03784.complete
Subject Subject Range Query Range Percent Splice Strand
CG3513-RA 1..267 576..842 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:05:23 Download gff for IP03784.complete
Subject Subject Range Query Range Percent Splice Strand
CG3513-RA 1..267 576..842 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:08:53 Download gff for IP03784.complete
Subject Subject Range Query Range Percent Splice Strand
CG3513-RA 1..267 576..842 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:22:16 Download gff for IP03784.complete
Subject Subject Range Query Range Percent Splice Strand
CG3513-RA 1..267 576..842 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:21:27 Download gff for IP03784.complete
Subject Subject Range Query Range Percent Splice Strand
CG3513-RA 1..423 562..984 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:51:40 Download gff for IP03784.complete
Subject Subject Range Query Range Percent Splice Strand
Acp24A4-RC 1..126 7..132 100 -> Plus
Acp24A4-RC 210..637 133..560 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:05:23 Download gff for IP03784.complete
Subject Subject Range Query Range Percent Splice Strand
CG3513-RA 1..267 576..842 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:08:53 Download gff for IP03784.complete
Subject Subject Range Query Range Percent Splice Strand
Acp24A4-RC 11..142 1..132 100 -> Plus
Acp24A4-RC 226..653 133..560 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:42:07 Download gff for IP03784.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3693695..3693724 103..132 100 <- Minus
2L 3693794..3693895 1..102 100   Minus
2L 3692699..3693028 655..984 100 <- Minus
2L 3693090..3693611 133..654 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:42:07 Download gff for IP03784.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3693695..3693724 103..132 100 <- Minus
2L 3693794..3693895 1..102 100   Minus
2L 3692699..3693028 655..984 100 <- Minus
2L 3693090..3693611 133..654 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 00:42:07 Download gff for IP03784.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3693695..3693724 103..132 100 <- Minus
2L 3693794..3693895 1..102 100   Minus
2L 3692699..3693028 655..984 100 <- Minus
2L 3693090..3693611 133..654 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:51:40 Download gff for IP03784.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 3692699..3693028 655..984 100 <- Minus
arm_2L 3693090..3693611 133..654 100 <- Minus
arm_2L 3693695..3693724 103..132 100 <- Minus
arm_2L 3693794..3693895 1..102 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:41:45 Download gff for IP03784.complete
Subject Subject Range Query Range Percent Splice Strand
2L 3692699..3693028 655..984 100 <- Minus
2L 3693090..3693611 133..654 100 <- Minus
2L 3693695..3693724 103..132 100 <- Minus
2L 3693794..3693895 1..102 100   Minus

IP03784.pep Sequence

Translation from 575 to 841

> IP03784.pep
MKYIGFVAIAFLLSLSGSRLWVHAKPEMCQQPSSMVGMAQDGAACMAFMP
AWTYDASKNACTEFIFGGCGGNSNQFSTKSECEKACKD*

IP03784.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:46:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14656-PA 88 GF14656-PA 1..88 1..88 342 72.7 Plus
Dana\GF14655-PA 81 GF14655-PA 4..81 9..88 162 38.3 Plus
Dana\GF19682-PA 82 GF19682-PA 4..80 3..86 160 39.3 Plus
Dana\GF15247-PA 82 GF15247-PA 21..82 30..88 151 43.5 Plus
Dana\GF14654-PA 82 GF14654-PA 1..82 1..88 142 36.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:47:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24418-PA 90 GG24418-PA 1..90 1..88 407 85.6 Plus
Dere\GG16686-PA 84 GG16686-PA 3..82 7..86 166 37.5 Plus
Dere\GG24413-PA 82 GG24413-PA 21..80 25..86 164 41.9 Plus
Dere\GG24416-PA 78 GG24416-PA 21..78 25..88 162 45.3 Plus
Dere\GG24412-PA 82 GG24412-PA 1..80 1..86 161 41.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:47:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22482-PA 86 GH22482-PA 1..86 1..88 265 57.8 Plus
Dgri\GH13182-PA 86 GH13182-PA 1..86 1..88 219 50 Plus
Dgri\GH13180-PA 81 GH13180-PA 1..80 1..86 159 36.8 Plus
Dgri\GH25268-PA 83 GH25268-PA 1..83 1..88 147 40.4 Plus
Dgri\GH22481-PA 83 GH22481-PA 39..83 44..88 145 48.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG3513-PA 88 CG3513-PA 1..88 1..88 479 100 Plus
CG16713-PA 82 CG16713-PA 8..80 6..86 168 40.2 Plus
IM33-PB 82 CG16712-PB 1..82 1..88 158 37.5 Plus
IM33-PA 82 CG16712-PA 1..82 1..88 158 37.5 Plus
CG2816-PB 84 CG2816-PB 40..83 45..88 141 50 Plus
CG3604-PB 132 CG3604-PB 52..105 26..86 137 37.7 Plus
CG3604-PA 132 CG3604-PA 52..105 26..86 137 37.7 Plus
Acp24A4-PC 78 CG31779-PC 21..76 25..86 136 40.3 Plus
Acp24A4-PB 78 CG31779-PB 21..76 25..86 136 40.3 Plus
CG42464-PA 87 CG42464-PA 2..82 6..88 134 35.7 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:47:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17762-PA 86 GI17762-PA 5..86 3..88 281 61.6 Plus
Dmoj\GI17758-PA 82 GI17758-PA 5..82 4..88 168 40 Plus
Dmoj\GI23877-PA 82 GI23877-PA 18..82 22..88 159 44.8 Plus
Dmoj\GI17757-PA 82 GI17757-PA 1..82 1..88 158 39.6 Plus
Dmoj\GI17759-PA 82 GI17759-PA 21..80 25..86 154 45.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:47:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19464-PA 89 GL19464-PA 1..89 1..88 344 71.9 Plus
Dper\GL19427-PA 78 GL19427-PA 1..78 1..88 162 38.6 Plus
Dper\GL19459-PA 82 GL19459-PA 3..82 6..88 162 41 Plus
Dper\GL19461-PA 78 GL19461-PA 21..76 25..86 157 45.2 Plus
Dper\GL19462-PA 82 GL19462-PA 21..80 25..86 148 41.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:47:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17493-PA 89 GA17493-PA 1..89 1..88 342 71.9 Plus
Dpse\GA14098-PA 82 GA14098-PA 1..82 1..88 161 38.2 Plus
Dpse\GA25970-PA 78 GA25970-PA 21..78 25..88 154 42.2 Plus
Dpse\GA25956-PA 78 GA25956-PA 1..78 1..88 154 37.5 Plus
Dpse\GA25969-PA 80 GA25969-PA 21..80 25..88 152 46.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:47:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18130-PA 88 GM18130-PA 1..88 1..88 455 96.6 Plus
Dsec\GM18128-PA 82 GM18128-PA 10..80 3..86 161 40 Plus
Dsec\GM18127-PA 82 GM18127-PA 1..82 1..88 150 36.4 Plus
Dsec\GM18428-PA 91 GM18428-PA 36..90 27..88 137 41.9 Plus
Dsec\GM18125-PA 130 GM18125-PA 50..103 26..86 132 37.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:47:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22737-PA 88 GD22737-PA 1..88 1..88 452 95.5 Plus
Dsim\GD22735-PA 82 GD22735-PA 10..80 3..86 161 40 Plus
Dsim\GD22734-PA 82 GD22734-PA 1..82 1..88 151 36.4 Plus
Dsim\GD23247-PA 91 GD23247-PA 36..90 27..88 136 41.9 Plus
Dsim\GD22733-PA 130 GD22733-PA 50..103 26..86 132 37.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:47:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16348-PA 86 GJ16348-PA 4..86 2..88 307 66.7 Plus
Dvir\GJ17586-PA 82 GJ17586-PA 21..80 25..86 165 46.8 Plus
Dvir\GJ17585-PA 82 GJ17585-PA 6..82 8..88 145 39.5 Plus
Dvir\GJ21125-PA 80 GJ21125-PA 1..78 1..86 137 34.9 Plus
Dvir\GJ17584-PA 144 GJ17584-PA 51..104 26..86 135 41 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:47:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15471-PA 90 GK15471-PA 1..90 1..88 331 72.2 Plus
Dwil\GK15469-PA 80 GK15469-PA 3..78 6..86 145 38.3 Plus
Dwil\GK10999-PA 2909 GK10999-PA 2182..2250 19..86 145 42 Plus
Dwil\GK14644-PA 82 GK14644-PA 27..81 27..88 140 41.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:47:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14817-PA 106 GE14817-PA 19..106 1..88 402 84.1 Plus
Dyak\GE17972-PA 84 GE17972-PA 21..82 25..86 187 50 Plus
Dyak\GE14816-PA 82 GE14816-PA 21..80 25..86 160 41.9 Plus
Dyak\GE14815-PA 82 GE14815-PA 1..82 1..88 144 35.2 Plus
Dyak\GE14811-PA 130 GE14811-PA 52..105 26..86 133 37.7 Plus

IP03784.hyp Sequence

Translation from 575 to 841

> IP03784.hyp
MKYIGFVAIAFLLSLSGSRLWVHAKPEMCQQPSSMVGMAQDGAACMAFMP
AWTYDASKNACTEFIFGGCGGNSNQFSTKSECEKACKD*

IP03784.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:06:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG3513-PA 88 CG3513-PA 1..88 1..88 479 100 Plus
CG16713-PA 82 CG16713-PA 8..80 6..86 168 40.2 Plus
CG16712-PB 82 CG16712-PB 1..82 1..88 158 37.5 Plus
CG16712-PA 82 CG16712-PA 1..82 1..88 158 37.5 Plus
CG2816-PB 84 CG2816-PB 40..83 45..88 141 50 Plus