BDGP Sequence Production Resources |
Search the DGRC for IP03802
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 38 |
Well: | 2 |
Vector: | pOT2 |
Associated Gene/Transcript | CG15213-RA |
Protein status: | IP03802.pep: gold |
Preliminary Size: | 189 |
Sequenced Size: | 369 |
Gene | Date | Evidence |
---|---|---|
CG15213 | 2005-01-01 | Successful iPCR screen |
CG15213 | 2008-04-29 | Release 5.5 accounting |
CG15213 | 2008-08-15 | Release 5.9 accounting |
CG15213 | 2008-12-18 | 5.12 accounting |
369 bp (369 high quality bases) assembled on 2004-12-17
GenBank Submission: BT023688
> IP03802.complete TCAACGCGCAGTGCGAATCCATCGATCGATTACTACATACATCTAGCCAC ATACAACATGAAGTTCTTGCTCCTGAGCGTCTTCCTTTGCCTTGCCGTGT GCTTCATGGCCACCAGTGCTGCTCCTCGCGAGGAGGCCATTCCCGATGGC TTCGAAGGTCCTGGCAGTGAGTCCGTCAACCCATCCGACGACCAATCCTT CCTGCTCAAGCTGAAGCTGCTCAAGAAGCTGCTGTTCCTGGGCTAGACAC CACACCCTCACATTTATGGATTTATAGTTTAACTTAACATGTGTTTAGGT TTTTAAGAAGAAAAACAAGAGTGAAATTAAAGAAAGTATTTGGTAACGAA AAAAAAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 5125349..5125621 | 76..348 | 97 | <- | Minus |
chr3L | 5125681..5125755 | 1..75 | 98 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15213-RA | 1..189 | 58..246 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15213-RA | 1..189 | 58..246 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15213-RA | 1..189 | 58..246 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15213-RA | 1..189 | 58..246 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15213-RA | 1..189 | 58..246 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15213-RA | 1..189 | 58..246 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15213-RA | 19..366 | 1..348 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15213-RA | 19..366 | 1..348 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15213-RA | 1..189 | 58..246 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15213-RA | 19..366 | 1..348 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 5133128..5133202 | 1..75 | 100 | Minus | |
3L | 5132796..5133068 | 76..348 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 5133128..5133202 | 1..75 | 100 | Minus | |
3L | 5132796..5133068 | 76..348 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 5133128..5133202 | 1..75 | 100 | Minus | |
3L | 5132796..5133068 | 76..348 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 5125896..5126168 | 76..348 | 100 | <- | Minus |
arm_3L | 5126228..5126302 | 1..75 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 5125896..5126168 | 76..348 | 100 | <- | Minus |
3L | 5126228..5126302 | 1..75 | 100 | Minus |
Translation from 0 to 245
> IP03802.hyp STRSANPSIDYYIHLATYNMKFLLLSVFLCLAVCFMATSAAPREEAIPDG FEGPGSESVNPSDDQSFLLKLKLLKKLLFLG*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15213-PA | 62 | CG15213-PA | 1..62 | 20..81 | 312 | 100 | Plus |
Translation from 57 to 245
> IP03802.pep MKFLLLSVFLCLAVCFMATSAAPREEAIPDGFEGPGSESVNPSDDQSFLL KLKLLKKLLFLG*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF10476-PA | 62 | GF10476-PA | 1..47 | 1..47 | 206 | 80.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG14146-PA | 62 | GG14146-PA | 1..62 | 1..62 | 301 | 98.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH15280-PA | 62 | GH15280-PA | 1..47 | 1..47 | 201 | 80.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15213-PA | 62 | CG15213-PA | 1..62 | 1..62 | 312 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11988-PA | 62 | GI11988-PA | 1..47 | 1..47 | 196 | 74.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL22473-PA | 62 | GL22473-PA | 1..47 | 1..47 | 199 | 80.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13575-PA | 62 | GA13575-PA | 1..47 | 1..47 | 199 | 80.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM13933-PA | 62 | GM13933-PA | 1..47 | 1..47 | 231 | 93.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD13214-PA | 62 | GD13214-PA | 1..62 | 1..62 | 297 | 96.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12212-PA | 62 | GJ12212-PA | 1..47 | 1..47 | 201 | 78.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19825-PA | 62 | GK19825-PA | 1..49 | 1..49 | 178 | 75.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE20575-PA | 62 | GE20575-PA | 1..62 | 1..62 | 301 | 98.4 | Plus |