Clone IP03802 Report

Search the DGRC for IP03802

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:38
Well:2
Vector:pOT2
Associated Gene/TranscriptCG15213-RA
Protein status:IP03802.pep: gold
Preliminary Size:189
Sequenced Size:369

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15213 2005-01-01 Successful iPCR screen
CG15213 2008-04-29 Release 5.5 accounting
CG15213 2008-08-15 Release 5.9 accounting
CG15213 2008-12-18 5.12 accounting

Clone Sequence Records

IP03802.complete Sequence

369 bp (369 high quality bases) assembled on 2004-12-17

GenBank Submission: BT023688

> IP03802.complete
TCAACGCGCAGTGCGAATCCATCGATCGATTACTACATACATCTAGCCAC
ATACAACATGAAGTTCTTGCTCCTGAGCGTCTTCCTTTGCCTTGCCGTGT
GCTTCATGGCCACCAGTGCTGCTCCTCGCGAGGAGGCCATTCCCGATGGC
TTCGAAGGTCCTGGCAGTGAGTCCGTCAACCCATCCGACGACCAATCCTT
CCTGCTCAAGCTGAAGCTGCTCAAGAAGCTGCTGTTCCTGGGCTAGACAC
CACACCCTCACATTTATGGATTTATAGTTTAACTTAACATGTGTTTAGGT
TTTTAAGAAGAAAAACAAGAGTGAAATTAAAGAAAGTATTTGGTAACGAA
AAAAAAAAAAAAAAAAAAA

IP03802.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:50:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG15213-RA 693 CG15213-RA 202..552 1..351 1755 100 Plus
CG15213.a 857 CG15213.a 366..716 1..351 1755 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 17:05:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 5125351..5125622 346..75 1285 98.2 Minus
chr3L 24539361 chr3L 5125681..5125755 75..1 360 98.7 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:39:28 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 17:05:55
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 5132793..5133069 351..75 1385 100 Minus
3L 28110227 3L 5133128..5133202 75..1 375 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:39:44
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 5125893..5126169 351..75 1385 100 Minus
3L 28103327 3L 5126228..5126302 75..1 375 100 Minus
Blast to na_te.dros performed on 2019-03-15 17:05:56 has no hits.

IP03802.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 17:06:42 Download gff for IP03802.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 5125349..5125621 76..348 97 <- Minus
chr3L 5125681..5125755 1..75 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:21:45 Download gff for IP03802.complete
Subject Subject Range Query Range Percent Splice Strand
CG15213-RA 1..189 58..246 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:21:28 Download gff for IP03802.complete
Subject Subject Range Query Range Percent Splice Strand
CG15213-RA 1..189 58..246 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:27:07 Download gff for IP03802.complete
Subject Subject Range Query Range Percent Splice Strand
CG15213-RA 1..189 58..246 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:05:24 Download gff for IP03802.complete
Subject Subject Range Query Range Percent Splice Strand
CG15213-RA 1..189 58..246 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:25:50 Download gff for IP03802.complete
Subject Subject Range Query Range Percent Splice Strand
CG15213-RA 1..189 58..246 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:22:17 Download gff for IP03802.complete
Subject Subject Range Query Range Percent Splice Strand
CG15213-RA 1..189 58..246 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:21:28 Download gff for IP03802.complete
Subject Subject Range Query Range Percent Splice Strand
CG15213-RA 19..366 1..348 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:27:07 Download gff for IP03802.complete
Subject Subject Range Query Range Percent Splice Strand
CG15213-RA 19..366 1..348 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:05:24 Download gff for IP03802.complete
Subject Subject Range Query Range Percent Splice Strand
CG15213-RA 1..189 58..246 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:25:50 Download gff for IP03802.complete
Subject Subject Range Query Range Percent Splice Strand
CG15213-RA 19..366 1..348 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:06:42 Download gff for IP03802.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5133128..5133202 1..75 100   Minus
3L 5132796..5133068 76..348 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:06:42 Download gff for IP03802.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5133128..5133202 1..75 100   Minus
3L 5132796..5133068 76..348 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 17:06:42 Download gff for IP03802.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5133128..5133202 1..75 100   Minus
3L 5132796..5133068 76..348 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:27:07 Download gff for IP03802.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 5125896..5126168 76..348 100 <- Minus
arm_3L 5126228..5126302 1..75 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:41:47 Download gff for IP03802.complete
Subject Subject Range Query Range Percent Splice Strand
3L 5125896..5126168 76..348 100 <- Minus
3L 5126228..5126302 1..75 100   Minus

IP03802.hyp Sequence

Translation from 0 to 245

> IP03802.hyp
STRSANPSIDYYIHLATYNMKFLLLSVFLCLAVCFMATSAAPREEAIPDG
FEGPGSESVNPSDDQSFLLKLKLLKKLLFLG*

IP03802.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:06:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG15213-PA 62 CG15213-PA 1..62 20..81 312 100 Plus

IP03802.pep Sequence

Translation from 57 to 245

> IP03802.pep
MKFLLLSVFLCLAVCFMATSAAPREEAIPDGFEGPGSESVNPSDDQSFLL
KLKLLKKLLFLG*

IP03802.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:47:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10476-PA 62 GF10476-PA 1..47 1..47 206 80.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:47:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14146-PA 62 GG14146-PA 1..62 1..62 301 98.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:47:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15280-PA 62 GH15280-PA 1..47 1..47 201 80.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:32:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG15213-PA 62 CG15213-PA 1..62 1..62 312 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:47:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11988-PA 62 GI11988-PA 1..47 1..47 196 74.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:47:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22473-PA 62 GL22473-PA 1..47 1..47 199 80.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:47:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13575-PA 62 GA13575-PA 1..47 1..47 199 80.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:47:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13933-PA 62 GM13933-PA 1..47 1..47 231 93.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:47:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13214-PA 62 GD13214-PA 1..62 1..62 297 96.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:47:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12212-PA 62 GJ12212-PA 1..47 1..47 201 78.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:47:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19825-PA 62 GK19825-PA 1..49 1..49 178 75.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:47:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20575-PA 62 GE20575-PA 1..62 1..62 301 98.4 Plus