BDGP Sequence Production Resources |
Search the DGRC for IP03810
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 38 |
Well: | 10 |
Vector: | pOT2 |
Associated Gene/Transcript | CG15357-RA |
Protein status: | IP03810.pep: gold |
Preliminary Size: | 285 |
Sequenced Size: | 579 |
Gene | Date | Evidence |
---|---|---|
CG15357 | 2005-01-01 | Successful iPCR screen |
CG15357 | 2008-04-29 | Release 5.5 accounting |
CG15357 | 2008-08-15 | Release 5.9 accounting |
CG15357 | 2008-12-18 | 5.12 accounting |
579 bp (579 high quality bases) assembled on 2005-03-04
GenBank Submission: BT023092
> IP03810.complete ACATTCCCAATTTCGACGTGGATCAGTAGAAACCTAAAATCAATTCTCTA AAACATAATGACTTGCGAAGTGCAGAATTTCATAGATGGCATGTCGCAGA CTTTTTGTAAGCACAAAGAGATGCGCAAATGCCAAATGCTCGAGATCCTG GACAAAGTGCGCTCCTGCGATTGCTGCCACAAAAGAAGGCTAAACAACTG CCGGATGGTTAAGTCTGGAGGCCGGAAGCCCGCATCCCAGGGCTGGACAC TCTACCTCATCGCCGCCTGCTTCGCATTACTCCTGCTCATGATCATCTAT ATGATCCATGTGGCCAGAAGATATAACCATGTTCGAGCCTACGGCAGCAG CGCCTGCGGATCCACTTTGTTCTACAGCTACAGCGACTGCGATGTGTTCT ACTAGGGAATACTAACCAAGCTCACTTATATTTTGACTCAATTGTTCAAT AAAGCTATCCAATATCCATATCCATTGGATAAATTAATAGGTTTGTAAAG TAAGGCCATCATGCTAACTCCAAATTGACGCCGAATCAATACACACTTTT TCCACTGCTCAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15357-RA | 560 | CG15357-RA | 1..560 | 1..560 | 2800 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 1944943..1945502 | 560..1 | 2800 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 1945149..1945709 | 561..1 | 2805 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 1945149..1945709 | 561..1 | 2805 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 1944943..1945502 | 1..560 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15357-RA | 1..348 | 58..405 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15357-RA | 1..348 | 58..405 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15357-RA | 1..348 | 58..405 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15357-RA | 1..348 | 58..405 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15357-RA | 1..348 | 58..405 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15357-RA | 1..485 | 1..485 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15357-RA | 1..485 | 1..485 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15357-RB | 1..560 | 1..560 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15357-RA | 1..485 | 1..485 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG15357-RB | 1..560 | 1..560 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 1945150..1945709 | 1..560 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 1945150..1945709 | 1..560 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 1945150..1945709 | 1..560 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 1945150..1945709 | 1..560 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 1945150..1945709 | 1..560 | 100 | Minus |
Translation from 57 to 404
> IP03810.pep MTCEVQNFIDGMSQTFCKHKEMRKCQMLEILDKVRSCDCCHKRRLNNCRM VKSGGRKPASQGWTLYLIAACFALLLLMIIYMIHVARRYNHVRAYGSSAC GSTLFYSYSDCDVFY*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF15316-PA | 114 | GF15316-PA | 2..114 | 3..115 | 242 | 44.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG24568-PA | 116 | GG24568-PA | 4..116 | 3..115 | 497 | 83.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG15357-PB | 115 | CG15357-PB | 1..115 | 1..115 | 631 | 100 | Plus |
CG15357-PA | 115 | CG15357-PA | 1..115 | 1..115 | 631 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI16323-PA | 109 | GI16323-PA | 2..108 | 3..114 | 195 | 36.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL18463-PA | 108 | GL18463-PA | 3..108 | 4..115 | 167 | 33 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA13669-PA | 108 | GA13669-PA | 3..108 | 4..115 | 165 | 33 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM16581-PA | 115 | GM16581-PA | 1..115 | 1..115 | 563 | 90.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD22885-PA | 115 | GD22885-PA | 1..115 | 1..115 | 576 | 92.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ15663-PA | 109 | GJ15663-PA | 2..108 | 3..114 | 258 | 42.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19375-PA | 113 | GK19375-PA | 2..113 | 3..115 | 255 | 43.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE15313-PA | 115 | GE15313-PA | 1..115 | 1..115 | 507 | 81.7 | Plus |
Translation from 57 to 404
> IP03810.hyp MTCEVQNFIDGMSQTFCKHKEMRKCQMLEILDKVRSCDCCHKRRLNNCRM VKSGGRKPASQGWTLYLIAACFALLLLMIIYMIHVARRYNHVRAYGSSAC GSTLFYSYSDCDVFY*