Clone IP03810 Report

Search the DGRC for IP03810

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:38
Well:10
Vector:pOT2
Associated Gene/TranscriptCG15357-RA
Protein status:IP03810.pep: gold
Preliminary Size:285
Sequenced Size:579

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15357 2005-01-01 Successful iPCR screen
CG15357 2008-04-29 Release 5.5 accounting
CG15357 2008-08-15 Release 5.9 accounting
CG15357 2008-12-18 5.12 accounting

Clone Sequence Records

IP03810.complete Sequence

579 bp (579 high quality bases) assembled on 2005-03-04

GenBank Submission: BT023092

> IP03810.complete
ACATTCCCAATTTCGACGTGGATCAGTAGAAACCTAAAATCAATTCTCTA
AAACATAATGACTTGCGAAGTGCAGAATTTCATAGATGGCATGTCGCAGA
CTTTTTGTAAGCACAAAGAGATGCGCAAATGCCAAATGCTCGAGATCCTG
GACAAAGTGCGCTCCTGCGATTGCTGCCACAAAAGAAGGCTAAACAACTG
CCGGATGGTTAAGTCTGGAGGCCGGAAGCCCGCATCCCAGGGCTGGACAC
TCTACCTCATCGCCGCCTGCTTCGCATTACTCCTGCTCATGATCATCTAT
ATGATCCATGTGGCCAGAAGATATAACCATGTTCGAGCCTACGGCAGCAG
CGCCTGCGGATCCACTTTGTTCTACAGCTACAGCGACTGCGATGTGTTCT
ACTAGGGAATACTAACCAAGCTCACTTATATTTTGACTCAATTGTTCAAT
AAAGCTATCCAATATCCATATCCATTGGATAAATTAATAGGTTTGTAAAG
TAAGGCCATCATGCTAACTCCAAATTGACGCCGAATCAATACACACTTTT
TCCACTGCTCAAAAAAAAAAAAAAAAAAA

IP03810.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:52:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG15357-RA 560 CG15357-RA 1..560 1..560 2800 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:17:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 1944943..1945502 560..1 2800 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:39:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:17:06
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1945149..1945709 561..1 2805 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:41:45
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1945149..1945709 561..1 2805 100 Minus
Blast to na_te.dros performed on 2019-03-16 01:17:06 has no hits.

IP03810.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:18:21 Download gff for IP03810.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 1944943..1945502 1..560 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:21:46 Download gff for IP03810.complete
Subject Subject Range Query Range Percent Splice Strand
CG15357-RA 1..348 58..405 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:24:33 Download gff for IP03810.complete
Subject Subject Range Query Range Percent Splice Strand
CG15357-RA 1..348 58..405 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:04:40 Download gff for IP03810.complete
Subject Subject Range Query Range Percent Splice Strand
CG15357-RA 1..348 58..405 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:08:45 Download gff for IP03810.complete
Subject Subject Range Query Range Percent Splice Strand
CG15357-RA 1..348 58..405 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:29:39 Download gff for IP03810.complete
Subject Subject Range Query Range Percent Splice Strand
CG15357-RA 1..348 58..405 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:26:37 Download gff for IP03810.complete
Subject Subject Range Query Range Percent Splice Strand
CG15357-RA 1..485 1..485 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:24:33 Download gff for IP03810.complete
Subject Subject Range Query Range Percent Splice Strand
CG15357-RA 1..485 1..485 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:04:40 Download gff for IP03810.complete
Subject Subject Range Query Range Percent Splice Strand
CG15357-RB 1..560 1..560 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:08:45 Download gff for IP03810.complete
Subject Subject Range Query Range Percent Splice Strand
CG15357-RA 1..485 1..485 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:29:39 Download gff for IP03810.complete
Subject Subject Range Query Range Percent Splice Strand
CG15357-RB 1..560 1..560 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:18:21 Download gff for IP03810.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1945150..1945709 1..560 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:18:21 Download gff for IP03810.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1945150..1945709 1..560 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:18:21 Download gff for IP03810.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1945150..1945709 1..560 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:04:40 Download gff for IP03810.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1945150..1945709 1..560 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:45:02 Download gff for IP03810.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1945150..1945709 1..560 100   Minus

IP03810.pep Sequence

Translation from 57 to 404

> IP03810.pep
MTCEVQNFIDGMSQTFCKHKEMRKCQMLEILDKVRSCDCCHKRRLNNCRM
VKSGGRKPASQGWTLYLIAACFALLLLMIIYMIHVARRYNHVRAYGSSAC
GSTLFYSYSDCDVFY*

IP03810.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 17:07:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF15316-PA 114 GF15316-PA 2..114 3..115 242 44.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 17:07:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24568-PA 116 GG24568-PA 4..116 3..115 497 83.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:27:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG15357-PB 115 CG15357-PB 1..115 1..115 631 100 Plus
CG15357-PA 115 CG15357-PA 1..115 1..115 631 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 17:07:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16323-PA 109 GI16323-PA 2..108 3..114 195 36.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 17:07:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18463-PA 108 GL18463-PA 3..108 4..115 167 33 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 17:07:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13669-PA 108 GA13669-PA 3..108 4..115 165 33 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 17:07:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16581-PA 115 GM16581-PA 1..115 1..115 563 90.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 17:07:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22885-PA 115 GD22885-PA 1..115 1..115 576 92.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 17:07:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15663-PA 109 GJ15663-PA 2..108 3..114 258 42.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 17:07:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19375-PA 113 GK19375-PA 2..113 3..115 255 43.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 17:07:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15313-PA 115 GE15313-PA 1..115 1..115 507 81.7 Plus

IP03810.hyp Sequence

Translation from 57 to 404

> IP03810.hyp
MTCEVQNFIDGMSQTFCKHKEMRKCQMLEILDKVRSCDCCHKRRLNNCRM
VKSGGRKPASQGWTLYLIAACFALLLLMIIYMIHVARRYNHVRAYGSSAC
GSTLFYSYSDCDVFY*

IP03810.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:07:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG15357-PB 115 CG15357-PB 1..115 1..115 631 100 Plus
CG15357-PA 115 CG15357-PA 1..115 1..115 631 100 Plus