Clone IP03934 Report

Search the DGRC for IP03934

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:39
Well:34
Vector:pOT2
Associated Gene/TranscriptCG17343-RA
Protein status:IP03934.pep: gold
Preliminary Size:255
Sequenced Size:541

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17343 2005-01-01 Successful iPCR screen
CG17343 2008-04-29 Release 5.5 accounting

Clone Sequence Records

IP03934.complete Sequence

541 bp (541 high quality bases) assembled on 2004-12-17

GenBank Submission: BT023685

> IP03934.complete
AAAACATCCCGGAAAAATGCGACGCCGCGAACTGCAGACCATCCAGCTGA
AGCTGTCCGATCTCAAGGAGTACGAGCAGGCTAAGATGGAGCGCCTGAGG
AACCGCCAACAATTGCTTACTCCCCGGACGCCTACACCCCCTTCCGACAG
CGAAGTCCTGCCGGCGACCTCCAGCAGCGTTCCAGCTGTTCTCCTGGCCA
GCGGCAAGAACCTGGACGATGACGCCGACAAGTCAGAGCCCACAACCAAG
CCCAGCACATCCTCCACCTAGGGTCTATACTTGAGCAAGCAATGGGAATT
AACACTTTGATCGTCACTACCTCAATGGATGAAGCACTTAGTTTTTAAGA
AATTGTATTTTGTAATTTACACTGTAAAAACATCTTGTGCTTTTTCGCGC
ACTGCAAGCGAAATTAGAATTGATCGTCGTAGTTCACTAATATATTTTAG
CTATACAATTAGACACCTCAATTAGTTGGTGCCAAACAGCCAGACTGTTA
AATATAAGAATTCTAAAAAATCGAAAAAAAAAAAAAAAAAA

IP03934.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:50:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG17343.a 602 CG17343.a 72..600 1..529 2645 100 Plus
CG10702-RB 4281 CG10702-RB 220..455 529..294 1180 100 Minus
CG10702.d 4227 CG10702.d 220..455 529..294 1180 100 Minus
CG10702-RB 4281 CG10702-RB 4194..4281 294..207 440 100 Minus
CG10702.d 4227 CG10702.d 4159..4227 274..206 345 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:48:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 19063579..19063872 1..294 1470 100 Plus
chr2L 23010047 chr2L 19068046..19068275 294..523 1120 99.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:39:53 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:48:16
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19064977..19065270 1..294 1470 100 Plus
2L 23513712 2L 19069444..19069679 294..529 1180 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:37:11
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19064977..19065270 1..294 1470 100 Plus
2L 23513712 2L 19069444..19069679 294..529 1180 100 Plus
Blast to na_te.dros performed on 2019-03-16 01:48:17 has no hits.

IP03934.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:49:16 Download gff for IP03934.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 19063579..19063871 1..293 100 -> Plus
chr2L 19068046..19068275 294..523 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:22:10 Download gff for IP03934.complete
Subject Subject Range Query Range Percent Splice Strand
CG17343-RA 1..255 17..271 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:17:27 Download gff for IP03934.complete
Subject Subject Range Query Range Percent Splice Strand
CG17343-RA 1..255 17..271 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:09:38 Download gff for IP03934.complete
Subject Subject Range Query Range Percent Splice Strand
CG17343-RA 1..255 17..271 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:05:25 Download gff for IP03934.complete
Subject Subject Range Query Range Percent Splice Strand
CG17343-RA 1..255 17..271 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:42:17 Download gff for IP03934.complete
Subject Subject Range Query Range Percent Splice Strand
CG17343-RA 1..255 17..271 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:22:20 Download gff for IP03934.complete
Subject Subject Range Query Range Percent Splice Strand
CG17343-RA 1..255 17..271 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:17:27 Download gff for IP03934.complete
Subject Subject Range Query Range Percent Splice Strand
CG17343-RA 1..523 1..523 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:09:38 Download gff for IP03934.complete
Subject Subject Range Query Range Percent Splice Strand
CG17343-RA 49..571 1..523 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:05:25 Download gff for IP03934.complete
Subject Subject Range Query Range Percent Splice Strand
CG17343-RA 1..255 17..271 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:42:17 Download gff for IP03934.complete
Subject Subject Range Query Range Percent Splice Strand
CG17343-RA 49..571 1..523 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:49:16 Download gff for IP03934.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19064977..19065269 1..293 100 -> Plus
2L 19069444..19069673 294..523 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:49:16 Download gff for IP03934.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19064977..19065269 1..293 100 -> Plus
2L 19069444..19069673 294..523 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:49:16 Download gff for IP03934.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19064977..19065269 1..293 100 -> Plus
2L 19069444..19069673 294..523 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:09:38 Download gff for IP03934.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19064977..19065269 1..293 100 -> Plus
arm_2L 19069444..19069673 294..523 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 13:37:33 Download gff for IP03934.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19064977..19065269 1..293 100 -> Plus
2L 19069444..19069673 294..523 100   Plus

IP03934.hyp Sequence

Translation from 0 to 270

> IP03934.hyp
KHPGKMRRRELQTIQLKLSDLKEYEQAKMERLRNRQQLLTPRTPTPPSDS
EVLPATSSSVPAVLLASGKNLDDDADKSEPTTKPSTSST*

IP03934.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 12:20:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG17343-PA 84 CG17343-PA 1..84 6..89 416 100 Plus

IP03934.pep Sequence

Translation from 16 to 270

> IP03934.pep
MRRRELQTIQLKLSDLKEYEQAKMERLRNRQQLLTPRTPTPPSDSEVLPA
TSSSVPAVLLASGKNLDDDADKSEPTTKPSTSST*

IP03934.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 16:46:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14698-PA 81 GF14698-PA 1..79 1..84 271 71.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 16:46:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21158-PA 84 GG21158-PA 1..84 1..84 404 97.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 16:46:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11084-PA 79 GH11084-PA 1..70 1..71 237 69 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:07:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG17343-PA 84 CG17343-PA 1..84 1..84 416 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 16:46:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17601-PA 81 GI17601-PA 1..78 1..80 231 63.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 16:46:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21180-PA 81 GL21180-PA 1..80 1..82 270 68.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 16:46:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14471-PA 81 GA14471-PA 1..80 1..82 270 68.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 16:46:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17323-PA 84 GM17323-PA 1..84 1..84 404 97.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 16:46:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24182-PA 84 GD24182-PA 1..84 1..84 402 97.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 16:46:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17946-PA 80 GJ17946-PA 1..71 1..70 227 67.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 16:46:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24651-PA 90 GK24651-PA 1..76 1..68 151 61.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 16:46:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13231-PA 84 GE13231-PA 1..84 1..84 392 94 Plus