BDGP Sequence Production Resources |
Search the DGRC for IP03934
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 39 |
Well: | 34 |
Vector: | pOT2 |
Associated Gene/Transcript | CG17343-RA |
Protein status: | IP03934.pep: gold |
Preliminary Size: | 255 |
Sequenced Size: | 541 |
Gene | Date | Evidence |
---|---|---|
CG17343 | 2005-01-01 | Successful iPCR screen |
CG17343 | 2008-04-29 | Release 5.5 accounting |
541 bp (541 high quality bases) assembled on 2004-12-17
GenBank Submission: BT023685
> IP03934.complete AAAACATCCCGGAAAAATGCGACGCCGCGAACTGCAGACCATCCAGCTGA AGCTGTCCGATCTCAAGGAGTACGAGCAGGCTAAGATGGAGCGCCTGAGG AACCGCCAACAATTGCTTACTCCCCGGACGCCTACACCCCCTTCCGACAG CGAAGTCCTGCCGGCGACCTCCAGCAGCGTTCCAGCTGTTCTCCTGGCCA GCGGCAAGAACCTGGACGATGACGCCGACAAGTCAGAGCCCACAACCAAG CCCAGCACATCCTCCACCTAGGGTCTATACTTGAGCAAGCAATGGGAATT AACACTTTGATCGTCACTACCTCAATGGATGAAGCACTTAGTTTTTAAGA AATTGTATTTTGTAATTTACACTGTAAAAACATCTTGTGCTTTTTCGCGC ACTGCAAGCGAAATTAGAATTGATCGTCGTAGTTCACTAATATATTTTAG CTATACAATTAGACACCTCAATTAGTTGGTGCCAAACAGCCAGACTGTTA AATATAAGAATTCTAAAAAATCGAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG17343.a | 602 | CG17343.a | 72..600 | 1..529 | 2645 | 100 | Plus |
CG10702-RB | 4281 | CG10702-RB | 220..455 | 529..294 | 1180 | 100 | Minus |
CG10702.d | 4227 | CG10702.d | 220..455 | 529..294 | 1180 | 100 | Minus |
CG10702-RB | 4281 | CG10702-RB | 4194..4281 | 294..207 | 440 | 100 | Minus |
CG10702.d | 4227 | CG10702.d | 4159..4227 | 274..206 | 345 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 19063579..19063871 | 1..293 | 100 | -> | Plus |
chr2L | 19068046..19068275 | 294..523 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17343-RA | 1..255 | 17..271 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17343-RA | 1..255 | 17..271 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17343-RA | 1..255 | 17..271 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17343-RA | 1..255 | 17..271 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17343-RA | 1..255 | 17..271 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17343-RA | 1..255 | 17..271 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17343-RA | 1..523 | 1..523 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17343-RA | 49..571 | 1..523 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17343-RA | 1..255 | 17..271 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17343-RA | 49..571 | 1..523 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 19064977..19065269 | 1..293 | 100 | -> | Plus |
2L | 19069444..19069673 | 294..523 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 19064977..19065269 | 1..293 | 100 | -> | Plus |
2L | 19069444..19069673 | 294..523 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 19064977..19065269 | 1..293 | 100 | -> | Plus |
2L | 19069444..19069673 | 294..523 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 19064977..19065269 | 1..293 | 100 | -> | Plus |
arm_2L | 19069444..19069673 | 294..523 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 19064977..19065269 | 1..293 | 100 | -> | Plus |
2L | 19069444..19069673 | 294..523 | 100 | Plus |
Translation from 0 to 270
> IP03934.hyp KHPGKMRRRELQTIQLKLSDLKEYEQAKMERLRNRQQLLTPRTPTPPSDS EVLPATSSSVPAVLLASGKNLDDDADKSEPTTKPSTSST*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG17343-PA | 84 | CG17343-PA | 1..84 | 6..89 | 416 | 100 | Plus |
Translation from 16 to 270
> IP03934.pep MRRRELQTIQLKLSDLKEYEQAKMERLRNRQQLLTPRTPTPPSDSEVLPA TSSSVPAVLLASGKNLDDDADKSEPTTKPSTSST*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14698-PA | 81 | GF14698-PA | 1..79 | 1..84 | 271 | 71.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21158-PA | 84 | GG21158-PA | 1..84 | 1..84 | 404 | 97.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH11084-PA | 79 | GH11084-PA | 1..70 | 1..71 | 237 | 69 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG17343-PA | 84 | CG17343-PA | 1..84 | 1..84 | 416 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17601-PA | 81 | GI17601-PA | 1..78 | 1..80 | 231 | 63.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL21180-PA | 81 | GL21180-PA | 1..80 | 1..82 | 270 | 68.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA14471-PA | 81 | GA14471-PA | 1..80 | 1..82 | 270 | 68.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM17323-PA | 84 | GM17323-PA | 1..84 | 1..84 | 404 | 97.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD24182-PA | 84 | GD24182-PA | 1..84 | 1..84 | 402 | 97.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17946-PA | 80 | GJ17946-PA | 1..71 | 1..70 | 227 | 67.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK24651-PA | 90 | GK24651-PA | 1..76 | 1..68 | 151 | 61.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13231-PA | 84 | GE13231-PA | 1..84 | 1..84 | 392 | 94 | Plus |