Clone IP03962 Report

Search the DGRC for IP03962

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:39
Well:62
Vector:pOT2
Associated Gene/TranscriptCG31477-RA
Protein status:IP03962.pep: gold
Preliminary Size:195
Sequenced Size:471

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG31477 2005-01-01 Successful iPCR screen
CG31477 2008-04-29 Release 5.5 accounting
CG31477 2008-08-15 Release 5.9 accounting
CG31477 2008-12-18 5.12 accounting

Clone Sequence Records

IP03962.complete Sequence

471 bp (471 high quality bases) assembled on 2008-12-15

GenBank Submission: BT023056.1

> IP03962.complete
AGGAGGTAGCAAGGCGCTTTGATTTAACTTACTTTGATATTGTAACTTAA
TGCAATTAAATATTAACATAGGCTTTACCAATCGTGTGCGAAATCTTGAA
AAGAAACCCGTCGCTCGGTTTTATATCGAATTCTTAACGGAAGAAGTTAA
TCCCATATTACTGCAAGATGAAAGCCTGGAGAGATCTGGGTATTACCTAT
ATCCAGTATTCCAACATCGCAGCCCGTGTGGTGCGAGAGGCCCTGCGCAT
TGAGCTCCGTGCAGACGCCGCCAAGCGAAACATCAGCCATGTGAAGTTCA
CTCCGTGGGTGAACGGAAAGCCTGTGCCGCGCAAGAAGGTAGAACGTGAA
TCCGAATCTTAGGCGCCCATTTCGGTGATTTGTACACCATGTTTCATCCA
GAATAACAGCTGCCATGATTCTACAATAACATTTCAAATAAATCTAATTC
ACTGAAAAAAAAAAAAAAAAA

IP03962.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:16:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG31477-RA 615 CG31477-RA 129..588 1..460 2300 100 Plus
CG31477-RB 615 CG31477-RB 129..588 1..460 2300 100 Plus
CG31477.a 511 CG31477.a 119..509 70..460 1955 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 18:46:29
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5947776..5948086 145..454 1505 99.7 Plus
chr3R 27901430 chr3R 5947580..5947722 8..150 700 99.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:40:04 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 18:46:27
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 10122003..10122318 145..460 1580 100 Plus
3R 32079331 3R 10121801..10121950 1..150 735 99.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:10:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 9862834..9863149 145..460 1580 100 Plus
3R 31820162 3R 9862632..9862781 1..150 735 99.3 Plus
Blast to na_te.dros performed 2019-03-15 18:46:28
Subject Length Description Subject Range Query Range Score Percent Strand
TAHRE 10463 TAHRE OSV 10463bp 3228..3269 65..106 111 73.8 Plus
Dyak\TART 8444 Dyak\TART TARTYAK 8444bp 4411..4504 120..213 108 65.3 Plus
TART-C 11124 TART-C TARTC 11124bp 5867..5960 120..213 108 65.3 Plus

IP03962.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 18:47:20 Download gff for IP03962.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5947572..5947718 1..146 99 -> Plus
chr3R 5947778..5948086 147..454 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:22:20 Download gff for IP03962.complete
Subject Subject Range Query Range Percent Splice Strand
CG31477-RB 1..195 168..362 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:28:40 Download gff for IP03962.complete
Subject Subject Range Query Range Percent Splice Strand
CG31477-RB 1..195 168..362 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:30:39 Download gff for IP03962.complete
Subject Subject Range Query Range Percent Splice Strand
CG31477-RA 1..195 168..362 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:52:44 Download gff for IP03962.complete
Subject Subject Range Query Range Percent Splice Strand
CG31477-RB 1..195 168..362 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:00:15 Download gff for IP03962.complete
Subject Subject Range Query Range Percent Splice Strand
CG31477-RA 1..195 168..362 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-12-15 13:41:00 Download gff for IP03962.complete
Subject Subject Range Query Range Percent Splice Strand
CG31477-RA 1..454 1..454 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:28:40 Download gff for IP03962.complete
Subject Subject Range Query Range Percent Splice Strand
CG31477-RB 1..454 1..454 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:30:39 Download gff for IP03962.complete
Subject Subject Range Query Range Percent Splice Strand
CG31477-RA 29..482 1..454 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:52:44 Download gff for IP03962.complete
Subject Subject Range Query Range Percent Splice Strand
CG31477-RB 1..452 3..454 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:00:15 Download gff for IP03962.complete
Subject Subject Range Query Range Percent Splice Strand
CG31477-RA 29..482 1..454 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:47:20 Download gff for IP03962.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10121801..10121946 1..146 100 -> Plus
3R 10122005..10122312 147..454 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:47:20 Download gff for IP03962.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10121801..10121946 1..146 100 -> Plus
3R 10122005..10122312 147..454 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 18:47:20 Download gff for IP03962.complete
Subject Subject Range Query Range Percent Splice Strand
3R 10121801..10121946 1..146 100 -> Plus
3R 10122005..10122312 147..454 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:30:39 Download gff for IP03962.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5947523..5947668 1..146 100 -> Plus
arm_3R 5947727..5948034 147..454 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:54:52 Download gff for IP03962.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9862632..9862777 1..146 100 -> Plus
3R 9862836..9863143 147..454 100   Plus

IP03962.hyp Sequence

Translation from 49 to 252

> IP03962.hyp
MQLNINIGFTNRVRNLEKKPVARFYIEFLTEEVNPILLQDESLERSGYYL
YPVFQHRSPCGARGPAH*
Sequence IP03962.hyp has no blast hits.

IP03962.pep Sequence

Translation from 167 to 361

> IP03962.pep
MKAWRDLGITYIQYSNIAARVVREALRIELRADAAKRNISHVKFTPWVNG
KPVPRKKVERESES*

IP03962.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 11:06:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17416-PA 82 GF17416-PA 1..52 1..52 233 84.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 11:06:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17423-PA 64 GG17423-PA 1..64 1..64 289 85.9 Plus
Dere\GG19366-PA 61 GG19366-PA 1..61 1..64 229 68.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 11:06:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12534-PA 56 GH12534-PA 4..54 3..53 218 80.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:10:11
Subject Length Description Subject Range Query Range Score Percent Strand
ATPsynepsilonL-PC 64 CG31477-PC 1..64 1..64 328 100 Plus
ATPsynepsilonL-PB 64 CG31477-PB 1..64 1..64 328 100 Plus
ATPsynepsilonL-PA 64 CG31477-PA 1..64 1..64 328 100 Plus
sun-PA 61 CG9032-PA 1..61 1..64 221 68.8 Plus
sun-PB 57 CG9032-PB 1..52 1..52 215 76.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 11:06:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11196-PA 56 GI11196-PA 4..54 3..53 217 78.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 11:06:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18058-PA 62 GL18058-PA 4..62 3..64 242 75.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 11:06:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21492-PA 62 GA21492-PA 4..62 3..64 242 75.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 11:06:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23863-PA 64 GM23863-PA 1..64 1..64 312 95.3 Plus
Dsec\GM22520-PA 61 GM22520-PA 1..61 1..64 229 68.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 11:06:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD18671-PA 64 GD18671-PA 1..63 1..63 307 95.2 Plus
Dsim\GD24676-PA 61 GD24676-PA 1..61 1..64 229 68.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 11:07:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18479-PA 56 GJ18479-PA 4..54 3..53 210 76.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 11:07:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19782-PA 62 GK19782-PA 4..62 3..64 244 77.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 11:07:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26014-PA 64 GE26014-PA 1..64 1..64 280 84.4 Plus
Dyak\GE16014-PA 61 GE16014-PA 1..61 1..64 229 68.8 Plus