Clone IP03973 Report

Search the DGRC for IP03973

Clone and Library Details

Library:IP
Tissue Source:Pooled D melanogaster cDNA libraries
Created by: 
Date Registered:2004-07-08
Comments: 
Original Plate Number:39
Well:73
Vector:pOT2
Associated Gene/TranscriptRad1-RA
Protein status:IP03973.pep2: gold IP03973.pep: gold
Preliminary Size:1495
Sequenced Size:1502

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3240 2005-01-01 Successful iPCR screen
Rad1 2008-04-29 Release 5.5 accounting
Rad1 2008-08-15 Release 5.9 accounting
CG34314 2008-08-15 Release 5.9 accounting
Rad1 2008-12-18 5.12 accounting
CG34314 2008-12-18 5.12 accounting

Clone Sequence Records

IP03973.complete Sequence

1502 bp (1502 high quality bases) assembled on 2006-01-24

GenBank Submission: BT024410.1

> IP03973.complete
CCTGACGACTTTTTGGCGGTATTGTTTATAAACAAAATTCACTTAAGAAA
CTGGATTTAATAATGTCCTGAATGGCGTCCGAGTCAGAAAACACTACATC
CTATTTTGTTCCGCATCTGGTTGATCAAGTCTTCGAATTATATCGGAGTA
AAGCAGAGTCCAACAGCCTTACAAAAGAGGAACGCGGACAGTTCTTTTAC
GATCTATCCATTTTATTGGGCCAAGAACTGGTCCTGCGATCGCTACACCT
CTTGGACGACCACAACTTCTCCTTCTTCCACGCCAAGAACAATCGATCCG
TGTGCGTGGTAGAAATTTCCAAGGGAACCGAGTACTTCCGCTTGATTCCG
GGCGTAAGTTTCTGCAAGTGTGAGTTCTTCCAGTGCCACGTGCTGCAGTT
GCCGCGAGGCATCCTCTACCAGGACCTTCCCAGTGGCGAACCGGGCATTT
TAGAGGATTGGAGCGAGGAGAGCCGGGTGTCCTACACCTGCCAGCACATC
CTGGCATTGCGGCTCCATCAATTTCTGAAGCACACGGGCGGGAAAACCAC
CGAGAAGATCCTTAAGAAAGAGGATATCAAGGAGCTGCGGACGGACGTCT
TTCGGGACTAGGATGACTGATGTGGAGCCATCGCCCTACGGCGACTGCAA
ATTCGTCGCTCGAGTGGAGCACATCAAGACCTTCATCCAGGCCATCAAGT
CAATCTGCTTTAATGATTATGGGATGGTGCAAGTCTCCGAAGATGGTCTG
CGCATCACCGTGGAGCAGGGCAAGTCCATCCAGGCAACGCTTTTCATGCC
GCCGGGTGCCTTCATGGAGTTCCGTGTGCAGGACTTCCAGTGCTTCGGTG
TGAAAATGAATGTGCTGTCCGAGTGTCTCAGTCTCTTCGGATCCGCCGAT
TGCAGCCTGCGAATGATGTACAGGGATAAGGGCGATCCCCTGAAGATAAT
TCTGTATCCGCACGACGACGATGATGTGAGCACGGAGTGCGCCATCAAAA
CCATGGACTGCGATGAGCCCATTGACTACGATCAGAATCTGAAGGATCCG
GATCTTAATGTTATTTTCGTACGCGGACCGAACCTATCGAAGGTGTTCAA
TGAGCTGGAGAAGTCCGCGGAGGAGTTCGAGTTCGTGACATCGCCGAACC
GCCCGCACTTTAAGATCACCACAGTGGGGATCATGCAGGCGGTGTTCAGC
GTCGAAGTGGCAAAGACGAGTCCCATGATGATGATGTTTAACTGCAAACA
GACGGTGGTGGCTCGCTACAAGAGCCAGCAGATCCGCATGACCAACAAGG
CGATGCAGTCGGCCACCAAGGTGGCCATTAAAACGAACTCCGTTGGCCTC
CTAGAACTGCATCTGGTAATGCAGGGCGATAGCCAGGAGGAGATATTCAT
TCAGTTCTTCATAATTCCTTTGCTCAACACTGATTAAACCGAAACTACTA
GGTAGCTAATAAAATAGAACTTTAAAATATTGCTAAAAAAAAAAAAAAAA
AA

IP03973.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:20:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG34314-RA 1524 CG34314-RA 29..1516 1..1488 7440 100 Plus
Rad1-RA 1524 Rad1-RA 29..1516 1..1488 7440 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 12:07:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2573229..2573995 1484..718 3835 100 Minus
chr2L 23010047 chr2L 2574069..2574610 717..176 2710 100 Minus
chr2L 23010047 chr2L 2574669..2574845 177..1 885 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 17:40:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 12:07:30
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2573432..2574202 1488..718 3855 100 Minus
2L 23513712 2L 2574276..2574817 717..176 2710 100 Minus
2L 23513712 2L 2574876..2575052 177..1 885 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:13:14
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2573432..2574202 1488..718 3855 100 Minus
2L 23513712 2L 2574276..2574817 717..176 2710 100 Minus
2L 23513712 2L 2574876..2575052 177..1 885 100 Minus
Blast to na_te.dros performed 2019-03-15 12:07:30
Subject Length Description Subject Range Query Range Score Percent Strand
G5A 2841 G5A G5A 2841bp 1400..1438 323..284 116 80 Minus

IP03973.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 12:08:11 Download gff for IP03973.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2573229..2573995 718..1484 100 <- Minus
chr2L 2574069..2574608 178..717 100 <- Minus
chr2L 2574669..2574845 1..177 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 17:22:22 Download gff for IP03973.complete
Subject Subject Range Query Range Percent Splice Strand
Rad1-RA 1..825 613..1437 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:36:22 Download gff for IP03973.complete
Subject Subject Range Query Range Percent Splice Strand
Rad1-RA 1..825 613..1437 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 21:37:55 Download gff for IP03973.complete
Subject Subject Range Query Range Percent Splice Strand
Rad1-RA 1..825 613..1437 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 16:11:02 Download gff for IP03973.complete
Subject Subject Range Query Range Percent Splice Strand
Rad1-RA 1..825 613..1437 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 17:52:28 Download gff for IP03973.complete
Subject Subject Range Query Range Percent Splice Strand
Rad1-RA 1..825 613..1437 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 18:07:48 Download gff for IP03973.complete
Subject Subject Range Query Range Percent Splice Strand
CG34314-RA 29..1512 1..1484 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:36:21 Download gff for IP03973.complete
Subject Subject Range Query Range Percent Splice Strand
CG34314-RA 29..1512 1..1484 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 21:37:55 Download gff for IP03973.complete
Subject Subject Range Query Range Percent Splice Strand
Rad1-RA 1..1484 1..1484 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 16:11:02 Download gff for IP03973.complete
Subject Subject Range Query Range Percent Splice Strand
CG34314-RA 29..1512 1..1484 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 17:52:28 Download gff for IP03973.complete
Subject Subject Range Query Range Percent Splice Strand
CG34314-RA 1..1484 1..1484 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:08:11 Download gff for IP03973.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2573436..2574202 718..1484 100 <- Minus
2L 2574276..2574815 178..717 100 <- Minus
2L 2574876..2575052 1..177 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:08:11 Download gff for IP03973.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2573436..2574202 718..1484 100 <- Minus
2L 2574276..2574815 178..717 100 <- Minus
2L 2574876..2575052 1..177 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 12:08:11 Download gff for IP03973.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2573436..2574202 718..1484 100 <- Minus
2L 2574276..2574815 178..717 100 <- Minus
2L 2574876..2575052 1..177 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 21:37:55 Download gff for IP03973.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2573436..2574202 718..1484 100 <- Minus
arm_2L 2574276..2574815 178..717 100 <- Minus
arm_2L 2574876..2575052 1..177 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:59:51 Download gff for IP03973.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2573436..2574202 718..1484 100 <- Minus
2L 2574276..2574815 178..717 100 <- Minus
2L 2574876..2575052 1..177 100   Minus

IP03973.pep2 Sequence

Translation from 71 to 610

> IP03973.pep2
MASESENTTSYFVPHLVDQVFELYRSKAESNSLTKEERGQFFYDLSILLG
QELVLRSLHLLDDHNFSFFHAKNNRSVCVVEISKGTEYFRLIPGVSFCKC
EFFQCHVLQLPRGILYQDLPSGEPGILEDWSEESRVSYTCQHILALRLHQ
FLKHTGGKTTEKILKKEDIKELRTDVFRD*

IP03973.pep2 Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 12:15:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24507-PA 179 GG24507-PA 1..179 1..179 837 88.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:55:58
Subject Length Description Subject Range Query Range Score Percent Strand
Sws1-PA 179 CG34314-PA 1..179 1..179 941 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 12:15:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26459-PA 175 GL26459-PA 1..175 1..179 490 51.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 12:15:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA28870-PA 175 GA28870-PA 1..175 1..179 490 51.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 12:15:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18216-PA 179 GM18216-PA 1..179 1..179 923 96.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 12:15:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22822-PA 179 GD22822-PA 1..179 1..179 917 96.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 12:15:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10151-PA 144 GJ10151-PA 6..144 37..179 182 31.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 12:16:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13471-PA 184 GK13471-PA 11..161 4..152 180 31 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 12:16:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15079-PA 165 GE15079-PA 1..165 1..179 735 79.3 Plus

IP03973.hyp Sequence

Translation from 612 to 1436

> IP03973.hyp
MTDVEPSPYGDCKFVARVEHIKTFIQAIKSICFNDYGMVQVSEDGLRITV
EQGKSIQATLFMPPGAFMEFRVQDFQCFGVKMNVLSECLSLFGSADCSLR
MMYRDKGDPLKIILYPHDDDDVSTECAIKTMDCDEPIDYDQNLKDPDLNV
IFVRGPNLSKVFNELEKSAEEFEFVTSPNRPHFKITTVGIMQAVFSVEVA
KTSPMMMMFNCKQTVVARYKSQQIRMTNKAMQSATKVAIKTNSVGLLELH
LVMQGDSQEEIFIQFFIIPLLNTD*

IP03973.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:50:48
Subject Length Description Subject Range Query Range Score Percent Strand
Rad1-PA 274 CG3240-PA 1..274 1..274 1423 100 Plus

IP03973.pep Sequence

Translation from 612 to 1436

> IP03973.pep
MTDVEPSPYGDCKFVARVEHIKTFIQAIKSICFNDYGMVQVSEDGLRITV
EQGKSIQATLFMPPGAFMEFRVQDFQCFGVKMNVLSECLSLFGSADCSLR
MMYRDKGDPLKIILYPHDDDDVSTECAIKTMDCDEPIDYDQNLKDPDLNV
IFVRGPNLSKVFNELEKSAEEFEFVTSPNRPHFKITTVGIMQAVFSVEVA
KTSPMMMMFNCKQTVVARYKSQQIRMTNKAMQSATKVAIKTNSVGLLELH
LVMQGDSQEEIFIQFFIIPLLNTD*

IP03973.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 13:19:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20598-PA 272 GF20598-PA 4..272 6..274 1241 85.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 13:19:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24508-PA 274 GG24508-PA 1..274 1..274 1425 96.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 13:19:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23116-PA 274 GH23116-PA 5..272 7..274 905 60.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:24
Subject Length Description Subject Range Query Range Score Percent Strand
Rad1-PA 274 CG3240-PA 1..274 1..274 1423 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 13:19:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10298-PA 274 GI10298-PA 5..272 7..274 909 60.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 13:19:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26460-PA 271 GL26460-PA 7..268 11..272 1187 80.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 13:19:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16873-PA 271 GA16873-PA 7..268 11..272 1196 80.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 13:19:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18217-PA 256 GM18217-PA 1..238 1..238 1261 98.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 13:19:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22824-PA 231 GD22824-PA 1..106 131..236 564 100 Plus
Dsim\GD22823-PA 110 GD22823-PA 1..92 1..92 475 94.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 13:19:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10152-PA 274 GJ10152-PA 5..272 7..274 920 61.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 13:19:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15006-PA 272 GK15006-PA 5..272 7..274 949 62.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 13:19:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15082-PA 274 GE15082-PA 1..274 1..274 1406 94.9 Plus