BDGP Sequence Production Resources |
Search the DGRC for IP04007
Library: | IP |
Tissue Source: | Pooled D melanogaster cDNA libraries |
Created by: | |
Date Registered: | 2004-07-08 |
Comments: | |
Original Plate Number: | 40 |
Well: | 7 |
Vector: | pOT2 |
Associated Gene/Transcript | CG11755-RA |
Protein status: | IP04007.pep: gold |
Preliminary Size: | 465 |
Sequenced Size: | 724 |
Gene | Date | Evidence |
---|---|---|
CG11755 | 2005-01-01 | Successful iPCR screen |
CG11755 | 2008-04-29 | Release 5.5 accounting |
CG11755 | 2008-08-15 | Release 5.9 accounting |
CG11755 | 2008-12-18 | 5.12 accounting |
724 bp (724 high quality bases) assembled on 2005-08-25
GenBank Submission: BT023862
> IP04007.complete TTTTTCTATTGGTCTTTTAGAAAATCTCAGACATGGATCCCGATGACGAC CTCGTCCTGGAGAATGAGGCAGAGGAAATTGAACGGTTACAGCTTCCCGA GGAGCTTAAAAAGCCCATTGATCCCGAGGAAGAGGATGAACGAGTAGCAC GCATCGAATTCAATTGTTCTGGCTGTGAAATGCACGAGATGGTCCATTAT TTTGGACGGAAACCGCCCTTTGCTCTAGGAGTCATATACCCAGAGGACAA CTACGTGATGCGAGATCCTTTCCAACCACCTCCACCTCGTTGGCAGTCAA AGCCGGAATACTATATCGCAATGGGGACTAAGTGCTCCATCTGCTCCAAG ACGGTGTGCAAGGATCCTGGCTGCAGTTTCTACTATACAGCCTCTTTTTG CTTGCCTTGTGGCAAGGAAGAATTAAAAAACTGGCCACCTGAGGCTCAAG CTCGAATAAGAAAACAAATGTCTGTCAGTCAAGGCAGGCAAACATAAATT AGTCTTTAAATATAAAACAGTAGTATGTAAAAATTATCTAAATAAGCAGT GAAAGAGCTATTGGCTAGAAAGGATACATTTTAAACTTTATTCAATAATG GAAACTCGCACTTATTCAAGTGCGGTTGATTGTATTGTTTGTATTGTATG CTTTCTAATGCTTAAATATTATTGCAAAGTAAAATAAAACCAATCTGAAG TTTAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG11755.a | 808 | CG11755.a | 124..808 | 19..703 | 3425 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3R | 27901430 | chr3R | 4504225..4504927 | 1..703 | 3455 | 99.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 32079331 | 3R | 8678253..8678956 | 1..704 | 3520 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3R | 31820162 | 3R | 8419084..8419787 | 1..704 | 3520 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 4504225..4504927 | 1..703 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11755-RA | 1..465 | 33..497 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11755-RA | 1..465 | 33..497 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11755-RA | 1..465 | 33..497 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11755-RA | 1..465 | 33..497 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11755-RA | 1..465 | 33..497 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11755-RA | 1..465 | 33..497 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11755-RA | 111..813 | 1..703 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11755-RA | 111..813 | 1..703 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11755-RA | 1..465 | 33..497 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11755-RA | 111..813 | 1..703 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 8678253..8678955 | 1..703 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 8678253..8678955 | 1..703 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 8678253..8678955 | 1..703 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 4503975..4504677 | 1..703 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 8419084..8419786 | 1..703 | 100 | Plus |
Translation from 32 to 496
> IP04007.pep MDPDDDLVLENEAEEIERLQLPEELKKPIDPEEEDERVARIEFNCSGCEM HEMVHYFGRKPPFALGVIYPEDNYVMRDPFQPPPPRWQSKPEYYIAMGTK CSICSKTVCKDPGCSFYYTASFCLPCGKEELKNWPPEAQARIRKQMSVSQ GRQT*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF19914-PA | 155 | GF19914-PA | 1..150 | 1..150 | 470 | 56.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG12047-PA | 157 | GG12047-PA | 4..157 | 1..154 | 711 | 84.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18008-PA | 164 | GH18008-PA | 11..161 | 2..153 | 505 | 56.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG11755-PB | 154 | CG11755-PB | 1..154 | 1..154 | 857 | 100 | Plus |
CG11755-PA | 154 | CG11755-PA | 1..154 | 1..154 | 857 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10517-PA | 158 | GI10517-PA | 12..155 | 4..148 | 547 | 66.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL23522-PA | 170 | GL23522-PA | 21..165 | 4..146 | 581 | 72.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11176-PA | 171 | GA11176-PA | 21..166 | 4..146 | 592 | 72.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM23752-PA | 154 | GM23752-PA | 1..154 | 1..154 | 799 | 96.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD18563-PA | 130 | GD18563-PA | 1..101 | 1..101 | 476 | 89.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23198-PA | 163 | GJ23198-PA | 27..163 | 12..150 | 502 | 62.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK10995-PA | 175 | GK10995-PA | 23..171 | 7..153 | 510 | 60 | Plus |
Dwil\GK12900-PA | 175 | GK12900-PA | 23..171 | 7..153 | 509 | 60 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE25895-PA | 154 | GE25895-PA | 1..154 | 1..154 | 731 | 86.4 | Plus |
Translation from 32 to 496
> IP04007.hyp MDPDDDLVLENEAEEIERLQLPEELKKPIDPEEEDERVARIEFNCSGCEM HEMVHYFGRKPPFALGVIYPEDNYVMRDPFQPPPPRWQSKPEYYIAMGTK CSICSKTVCKDPGCSFYYTASFCLPCGKEELKNWPPEAQARIRKQMSVSQ GRQT*